DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and GPROAR2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_024667085.1 Gene:GPROAR2 / 3292520 VectorBaseID:AGAP012698 Length:208 Species:Anopheles gambiae


Alignment Length:145 Identity:52/145 - (35%)
Similarity:74/145 - (51%) Gaps:9/145 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 MMRHGNAMLMHRP----SMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTL 413
            |.:...|....||    ....|..:||.|.:|...|.....:.|.......:..:|||.|.|:||
Mosquito    61 MSKFSGATFELRPINTVQFSASQISLSESCASNVTTNATKVRLHGKRIPIRISSLKRETKTAQTL 125

  Fly   414 GIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAF-R 477
            .:::|.||.||||||::|.|.....:....|.::..|.|:|:.||.:||.|||::|.|||.|| |
Mosquito   126 SMVVGGFIACWLPFFVYYLLMPFIPDDSKSDDLMEFLTWLGWINSAINPFIYAFYNVDFRVAFWR 190

  Fly   478 NTLLCLFCNWWKDRH 492
            .||...|    |::|
Mosquito   191 LTLRKFF----KNKH 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433
7tm_1 170..465 CDD:278431 37/115 (32%)
GPROAR2XP_024667085.1 7tm_GPCRs <110..188 CDD:333717 33/77 (43%)
TM helix 6 119..144 CDD:320095 13/24 (54%)
TM helix 7 156..181 CDD:320095 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.