DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar8a

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_783189.1 Gene:Taar8a / 319104 RGDID:631391 Length:374 Species:Rattus norvegicus


Alignment Length:334 Identity:108/334 - (32%)
Similarity:155/334 - (46%) Gaps:56/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VMLLII-----IAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGR 218
            |:|.::     :.|:||||||:|||:..::|....|:.:.|||.||.:|.|..|.|:....:...
  Rat    62 VLLYMVFGFGAVLAVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRSIESC 126

  Fly   219 WNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPAL 283
            |.|....|.|.:..|..|..:|:.|||.||||||.|:..||.||...|..|.||.:..:||.|.:
  Rat   127 WYFGDTFCSLHSCCDAAFCYSSLFHLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLV 191

  Fly   284 LSFLPIFIGWYTTPQHQQFVIQNPTQ-------CSFVVNKYYAVISSSISFWIPCTIMIFTYLAI 341
            .|....:.|...|.      |:|...       |..|||:.:.:| ..:.|.||..:||..|..|
  Rat   192 YSSAVFYTGISATG------IENLVSALNCVGGCQIVVNQDWVLI-DFLLFLIPTLVMIILYSKI 249

  Fly   342 FREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKRE 406
            |..|.:|..::                  ..::|||....:|..|:..            ..|||
  Rat   250 FLVAKQQAVKI------------------ETSISGSKGESSLESHKAR------------VAKRE 284

  Fly   407 HKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQ---VPDIVVSILFWIGYFNSTLNPLIYAYF 468
            .|||:|||:.:..|::.|||    ||:....:...   .|..|..|..|..|:||.:||||||:|
  Rat   285 RKAAKTLGVTVVAFMVSWLP----YTIDTLIDAFMGFITPAYVYEICCWSAYYNSAMNPLIYAFF 345

  Fly   469 NRDFREAFR 477
            ...||:|.:
  Rat   346 YPWFRKAIK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 65/189 (34%)
7tm_1 170..465 CDD:278431 97/304 (32%)
Taar8aNP_783189.1 7tm_4 72..357 CDD:304433 106/324 (33%)
7tm_1 78..342 CDD:278431 97/304 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.