DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Gpr63

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001100110.1 Gene:Gpr63 / 297952 RGDID:1306460 Length:425 Species:Rattus norvegicus


Alignment Length:457 Identity:114/457 - (24%)
Similarity:185/457 - (40%) Gaps:107/457 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VTAAALTTAAMLHTTNALAATGSSSAS----NSSTGGIALPLGTATPA-----THELNATQPFGG 120
            |.:..||..|:|.|.:    ||:|:.:    .:|...|..||....|:     .:.|......|.
  Rat     2 VVSGVLTAPAVLTTPH----TGTSNMTFVVYENSPMNITAPLPFQHPSPGPLLRYSLETMTSTGF 62

  Fly   121 SGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVW----VFKAF----------VMLLIIIAAICGN 171
            |.|..|.:                      :|.    |||:.          :|:.|:..:..||
  Rat    63 SSLAVNST----------------------VVTPAPAVFKSLNLALQIILSAIMIFILFVSFLGN 105

  Fly   172 LLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYF 236
            |:|.:.|.:...:|...|..:.|:|.||:::|::.|.|.....:|.||.|..|.|.|.......|
  Rat   106 LVVCLMVYQKAAMRSAINILLASMAFADMLLAVLNMPFALVTILTTRWIFGKFFCRLSAMFFWLF 170

  Fly   237 STASILHLCCISVDRYYAIVK------PLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYT 295
            ....:..|..||:||:..||:      |.:         ..:::..:|.:...::| |:.:|   
  Rat   171 VIEGVAILLIISIDRFLIIVQRQDKLNPYR---------AKVLIAVSWATAFSVAF-PLAVG--- 222

  Fly   296 TPQHQQFVIQNPTQCSF--VVN---KYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMR 355
            .|..|  :.....||.|  ..|   :.|.::.|.|||:||..:::::::.|..         .:|
  Rat   223 NPDLQ--IPSRAPQCVFGYTTNSGYQAYVILISLISFFIPFLVILYSFMGILN---------TLR 276

  Fly   356 HGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTF 420
            | ||:.:|   ..|.|..||.......::|....|..        |.|..:.:|..|:.|:...|
  Rat   277 H-NALRIH---SYPEGICLSQVSKLGLMSLQRPFQMS--------IDMSFKTRAFTTILILFAVF 329

  Fly   421 ILCWLPFFLWYTLSMTCEE---CQVPDIVVSI-LFWIGYFNSTLNPLIYAYFNRDFREAFRNTLL 481
            |:||.| |..|:|..|..:   .|.....:|. |.|:.|..|.||||||.:..:.|.:|      
  Rat   330 IVCWAP-FTTYSLVATFSKHFYYQHNFFEISTWLLWLCYLKSALNPLIYYWRIKKFHDA------ 387

  Fly   482 CL 483
            ||
  Rat   388 CL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 47/188 (25%)
7tm_1 170..465 CDD:278431 83/309 (27%)
Gpr63NP_001100110.1 7tmA_GPR63 88..388 CDD:320526 89/342 (26%)
TM helix 1 90..114 CDD:320526 7/23 (30%)
TM helix 2 123..145 CDD:320526 8/21 (38%)
TM helix 3 161..183 CDD:320526 4/21 (19%)
TM helix 4 203..219 CDD:320526 2/16 (13%)
TM helix 5 246..269 CDD:320526 7/22 (32%)
TM helix 6 319..341 CDD:320526 9/22 (41%)
TM helix 7 356..381 CDD:320526 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.