DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar7a

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_783175.1 Gene:Taar7a / 294125 RGDID:631387 Length:358 Species:Rattus norvegicus


Alignment Length:322 Identity:99/322 - (30%)
Similarity:152/322 - (47%) Gaps:51/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLW 229
            :.|:||||||:.|::..|:|....|:.|.|||.||.:|.:..|.|:....|.|.|.|....|...
  Rat    59 VLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGDTYCKFH 123

  Fly   230 NSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWY 294
            :..:..|..:||.|||.||||||.|:..||.||...|..|.|..:..:|:...:.||..::.|  
  Rat   124 SCFEGSFCYSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSFSLLYTG-- 186

  Fly   295 TTPQHQQFVIQNPT---QCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRH 356
            ......:.::...|   .|...||:.:..| :.:.|.:|..:|:..|..||..|.:|.:      
  Rat   187 ANEAGLEDLVSALTCVGGCQIAVNQSWVFI-NFLLFLVPTLVMMTVYSKIFLIAKQQAQ------ 244

  Fly   357 GNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKM-KREHKAARTLGIIMGTF 420
                                       .:.::.::.|...:.:..:: |||.|||:||||.:..|
  Rat   245 ---------------------------NIEKMSKQTTRASESYKDRVAKRERKAAKTLGIAVAAF 282

  Fly   421 ILCWLPFFLWYTLS-----MTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR 477
            :|.|||:|:...:.     :|      |..|..||.||.|:||.:||||||:|...||:|.:
  Rat   283 LLSWLPYFIDSIIDAFLGFIT------PTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 58/179 (32%)
7tm_1 170..465 CDD:278431 90/303 (30%)
Taar7aNP_783175.1 7tm_4 54..>184 CDD:304433 48/124 (39%)
7tm_1 64..326 CDD:278431 90/303 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.