DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar5

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001009650.1 Gene:Taar5 / 294123 RGDID:1359185 Length:337 Species:Rattus norvegicus


Alignment Length:332 Identity:106/332 - (31%)
Similarity:164/332 - (49%) Gaps:55/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
            ::::..|..||:.::    |||.|:.:|...:.|...||:.::|||:||:::.::.:..:....|
  Rat    36 LIYLACAVGMLITVL----GNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSV 96

  Fly   216 TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWIS 280
            ...|.|..|||.|...||..|...||.|||.||:||:.||..||.||...|.|:....:...|..
  Rat    97 ESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRIALRYIAAGWGI 161

  Fly   281 PALLSFLPIFIGWYTTPQHQ---QFVIQNPT--QCSFVVNKYYAVISSSISFWIPCTIMIFTYLA 340
            ||  ::...|:  ||....:   |::.:.|.  .|..:.||::..::.. :|:|||.|||..||.
  Rat   162 PA--AYTAFFL--YTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFP-AFFIPCLIMISLYLK 221

  Fly   341 IFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKR 405
            ||..|.||.:|:               :...::|||:                         :||
  Rat   222 IFVVATRQAQQI---------------RTLSQSLSGA-------------------------VKR 246

  Fly   406 EHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNR 470
            |.|||:||||.:|.:::|||||.: .||..:......|.:|..|..|..||||..||:||.:..|
  Rat   247 ERKAAKTLGIAVGIYLVCWLPFTV-DTLVDSLLNFVTPPLVFDIFIWFAYFNSACNPIIYVFSYR 310

  Fly   471 DFREAFR 477
            .||:|.:
  Rat   311 WFRKALK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 60/182 (33%)
7tm_1 170..465 CDD:278431 97/299 (32%)
Taar5NP_001009650.1 7tm_1 51..305 CDD:278431 97/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.