DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Ptgir

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001071112.1 Gene:Ptgir / 292661 RGDID:1310890 Length:416 Species:Rattus norvegicus


Alignment Length:413 Identity:84/413 - (20%)
Similarity:147/413 - (35%) Gaps:126/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LIIIAAICGNLLVIISVMRVRKLRVITNYF---VVSLAMADIM-------VAIMAMTFNFSVQVT 216
            |:.:|.:.||.|. :.::..|: |...:.|   |..||:.|::       ...:|...|.|  :.
  Rat    51 LMFVAGVVGNGLA-LGILGARR-RSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSS--LL 111

  Fly   217 GRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISP 281
            |..:....|||.:.....:|..||.|.|..::|:|..|:..|..|......|...:.|      |
  Rat   112 GLAHGGTMLCDTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARLAL------P 170

  Fly   282 ALLSFLPIF-------IGWYTTPQHQQFV----------IQNPTQCSF--VVNKYYAVISSSISF 327
            |:.:|..:|       :|     :|||:.          ...|..|:|  ......|::.:||.|
  Rat   171 AIYAFCCLFCSLPLLGLG-----EHQQYCPGSWCFIRMRSPQPGGCAFSLAYASLMALLVTSIFF 230

  Fly   328 WIPCTIMIFTYLA-IFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQE 391
               |...:...|. ::|:..|               |..|..|:..|                  
  Rat   231 ---CNGSVTLSLCHMYRQQRR---------------HHGSFVPTSRA------------------ 259

  Fly   392 HTPTKDK--HLIKMKREHKAARTLGIIMGTFILCWLPFFL-WYTLSMTCEECQVPDIVVSILFWI 453
               .:|:  |||          .|.::.|...:|.||..: .:|.::..:..::.|:..   |..
  Rat   260 ---REDEVYHLI----------LLALMTGIMAVCSLPLTIRGFTQAIAPDSREMGDLHA---FRF 308

  Fly   454 GYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSESY 518
            ..||..|:|.::..|.:...:..:..|.|| |                        |:||:.:..
  Rat   309 NAFNPILDPWVFILFRKAVFQRLKFWLCCL-C------------------------ARSVHGDLQ 348

  Fly   519 LNSTTP-SHRRQSQMVDNLXYRD 540
            ...:.| |.||.:...|:|..::
  Rat   349 TPLSRPVSGRRDTLAPDSLQAKE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 47/207 (23%)
7tm_1 170..465 CDD:278431 68/327 (21%)
PtgirNP_001071112.1 7tm_4 56..>247 CDD:304433 47/208 (23%)
7tm_1 59..319 CDD:278431 68/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.