DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and GPR78

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_543009.2 Gene:GPR78 / 27201 HGNCID:4528 Length:363 Species:Homo sapiens


Alignment Length:339 Identity:70/339 - (20%)
Similarity:141/339 - (41%) Gaps:65/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 AFVMLLIIIAAICGNLLVIISVMRVRKLRV-ITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWN 220
            |.::::::..|:..|.||::......:||. .:...:|:|::..:::|.:.|.|.....:.||..
Human     9 AGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDMPFTLLGVMRGRTP 73

  Fly   221 FSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLS 285
            .:|..|.:...||.:.::.:.|.:..:|.|::.|:..||:|...:..|..|::|...|......|
Human    74 SAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRPRYAGLLLGCAWGQSLAFS 138

  Fly   286 FLPIFIGW--YTT------------PQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIF 336
            ...:...|  |::            |:..:|..             :.....::.|.:|..::..
Human   139 GAALGCSWLGYSSAFASCSLRLPPEPERPRFAA-------------FTATLHAVGFVLPLAVLCL 190

  Fly   337 TYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLI 401
            |.|.:.|.|.|..:::                       .:.:.|.|.|  :...|...:.:.||
Human   191 TSLQVHRVARRHCQRM-----------------------DTVTMKALAL--LADLHPSVRQRCLI 230

  Fly   402 KMK-REHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWI-----GYFNSTL 460
            :.| |.|:|.|.:||.:.||::|:.|    |.::...|  .||.:.|:..:.|     .|..:..
Human   231 QQKRRRHRATRKIGIAIATFLICFAP----YVMTRLAE--LVPFVTVNAQWGILSKCLTYSKAVA 289

  Fly   461 NPLIYAYFNRDFRE 474
            :|..|:...|.||:
Human   290 DPFTYSLLRRPFRQ 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 37/192 (19%)
7tm_1 170..465 CDD:278431 64/315 (20%)
GPR78NP_543009.2 7tm_1 23..294 CDD:278431 64/314 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.