DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and OR1L1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001005236.3 Gene:OR1L1 / 26737 HGNCID:8213 Length:310 Species:Homo sapiens


Alignment Length:343 Identity:75/343 - (21%)
Similarity:128/343 - (37%) Gaps:79/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADI---MVAIMAMTFNFSVQVTGRWN 220
            |.|.|.:..:.||||:|:::....:|:....:|:..|:..||   .|.|..|..|| :..|...:
Human    30 VFLPIYLITVIGNLLIILAIRSDTRLQTPMYFFLSILSFVDICYVTVIIPKMLVNF-LSETKTIS 93

  Fly   221 FSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLS 285
            :|..|..::..| .:.:|.|.| |..:::|||.||..|..|...|:.|...::|:.::..|...|
Human    94 YSECLTQMYFFL-AFGNTDSYL-LAAMAIDRYVAICNPFHYITIMSHRCCVLLLVLSFCIPHFHS 156

  Fly   286 FLPIFIGWYTTPQ---------HQQFVIQNPT---QCSFVVNKYYAVISSSIS-FWIPCTIMIFT 337
            .|.|.:    |.|         |..|....|.   .||....|...|::..:: ...|.:.:|.:
Human   157 LLHILL----TNQLIFCASNVIHHFFCDDQPVLKLSCSSHFVKEITVMTEGLAVIMTPFSCIIIS 217

  Fly   338 YLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIK 402
            ||.|.                ..::..||.....:|.|..||..|:.                  
Human   218 YLRIL----------------ITVLKIPSAAGKRKAFSTCGSHLTVV------------------ 248

  Fly   403 MKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAY 467
                            |.....:.:..:..||....:.|:..|:.::|      ...|||.||:.
Human   249 ----------------TLFYGSISYLYFQPLSNYTVKDQIATIIYTVL------TPMLNPFIYSL 291

  Fly   468 FNRDFREAFRNTLLCLFC 485
            .|:|.::.....:..:.|
Human   292 RNKDMKQGLAKLMHRMKC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 50/193 (26%)
7tm_1 170..465 CDD:278431 67/310 (22%)
OR1L1NP_001005236.3 7tm_4 31..304 CDD:304433 73/335 (22%)
7tm_1 41..289 CDD:278431 67/310 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.