DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Drd5

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_036900.1 Gene:Drd5 / 25195 RGDID:2523 Length:475 Species:Rattus norvegicus


Alignment Length:457 Identity:144/457 - (31%)
Similarity:221/457 - (48%) Gaps:93/457 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VFKAFVMLLIIIAAICGNLLVIISVMRVRKLRV-ITNYFVVSLAMADIMVAIMAMTFNFSVQVTG 217
            |..|.::.|:|:..:.||:||..:::|.|.||. :||.|:||||::|:.||::.|.:....:|.|
  Rat    39 VVTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEVAG 103

  Fly   218 RWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPA 282
            .|.|..| ||:|.:.|:..||||||:||.||||||:||.:|.:|...||:||..:|:...|....
  Rat   104 YWPFGTF-CDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVGLAWTLSI 167

  Fly   283 LLSFLPIFIGWYT---------------TPQHQQFVIQNPTQ-CSFVVNKYYAVISSSISFWIPC 331
            |:||:|:.:.|:.               ||..:.:.::..|: |...:|:.||:.||.|||:||.
  Rat   168 LISFIPVQLNWHRDKAGSQGQEGLLSNGTPWEEGWELEGRTENCDSSLNRTYAISSSLISFYIPV 232

  Fly   332 TIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTK 396
            .|||.||..|:|.|..|.:::            .|::.:.|   .:.|.::...:|        .
  Rat   233 AIMIVTYTRIYRIAQVQIRRI------------SSLERAAE---HAQSCRSRGAYE--------P 274

  Fly   397 DKHL-IKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEE-----------CQVPDIVVSI 449
            |..| ..:|:|.|..:||.:|||.|:.||||||:...:...|..           | |.:....|
  Rat   275 DPSLRASIKKETKVFKTLSMIMGVFVCCWLPFFILNCMVPFCSSGDAEGPKTGFPC-VSETTFDI 338

  Fly   450 LFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCL-FCNWWKDRHLPLD-IDIRRSSLRYDQRA-- 510
            ..|.|:.||:|||:||| ||.|||:.|...|.|. ||     ...|:. ::|....:.|:|..  
  Rat   339 FVWFGWANSSLNPIIYA-FNADFRKVFAQLLGCSHFC-----FRTPVQTVNISNELISYNQDTVF 397

  Fly   511 --------------------KSVYSE---------SYLNSTTPSHRRQSQMVDNLXYRDEALLTP 546
                                :.|..|         |.::.|||.....::.|..| ..:|..|..
  Rat   398 HKEIATAYVHMIPNAVSSGDREVGEEEEEGPFDHMSQISPTTPDGDLAAESVWELDCEEEVSLGK 462

  Fly   547 IA 548
            |:
  Rat   463 IS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 77/194 (40%)
7tm_1 170..465 CDD:278431 112/323 (35%)
Drd5NP_036900.1 7tm_1 55..354 CDD:278431 112/323 (35%)
7tm_4 <121..>173 CDD:304433 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..443 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24248
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.