DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar6

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001010828.1 Gene:Taar6 / 215855 MGIID:2685074 Length:345 Species:Mus musculus


Alignment Length:317 Identity:98/317 - (30%)
Similarity:143/317 - (45%) Gaps:41/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLW 229
            :.|:.|||:|:||::..::|...||:.:.|||.||..|.|..|.|:....:...|.|....|...
Mouse    44 VLAVFGNLMVMISILHFKQLHSPTNFLIASLACADFGVGISVMPFSMVRSIESCWYFGRSFCTFH 108

  Fly   230 NSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWY 294
            ...||.|..:|:.||..||:|||.|:..||.||...|..|.||.:..:||.|.:.|....:.|.|
Mouse   109 TCCDVAFCYSSLFHLSFISIDRYIAVTDPLVYPTKFTVSVSGICIGVSWILPLVYSGAVFYTGVY 173

  Fly   295 TTPQHQQFVIQNPT-QCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGN 358
            .....:.....|.. .|..|||:.:.:| ..:||.||..:||..|..||..|.:|.|::      
Mouse   174 DDGLEELSSALNCVGGCQVVVNQNWVLI-DFLSFLIPTLVMIILYGNIFLVARQQAKKI------ 231

  Fly   359 AMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILC 423
                     :..|.....|..|....:                 .:||.|||:||||.:..|::.
Mouse   232 ---------ENIGSKTESSSESYKARV-----------------ARRERKAAKTLGITVVAFMIS 270

  Fly   424 WLPFFLWYTLSMTCEECQ---VPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR 477
            |||    |::....:...   .|..:..|..|..|:||.:||||||.|...|::|.:
Mouse   271 WLP----YSIDSLVDAFMGFITPAYIYEICVWCAYYNSAMNPLIYALFYPWFKKAIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 61/177 (34%)
7tm_1 170..465 CDD:278431 91/298 (31%)
Taar6NP_001010828.1 7tm_4 43..>271 CDD:304433 79/259 (31%)
7tm_1 49..311 CDD:278431 91/298 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.