DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar5

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001009574.1 Gene:Taar5 / 215854 MGIID:2685073 Length:337 Species:Mus musculus


Alignment Length:319 Identity:101/319 - (31%)
Similarity:157/319 - (49%) Gaps:51/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 IIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDL 228
            ::..:.|||.|:.:|...:.|...||:.::|||:||:::.::.:..:....|...|.|..|||.|
Mouse    45 VLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRL 109

  Fly   229 WNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGW 293
            ...||..|...||.|||.||:||:.||..||.||...|.|.....::..|..||  ::...|:  
Mouse   110 HTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPA--AYTAFFL-- 170

  Fly   294 YTTPQHQ---QFVIQNPT--QCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLM 353
            ||....:   |::.:.|.  .|..:.||::..::.. :|::||.|||..||.||..|.||.:|: 
Mouse   171 YTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFP-AFFVPCLIMISLYLKIFVVATRQAQQI- 233

  Fly   354 MRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMG 418
                          :...::|:|:                         :|||.|||:||||.:|
Mouse   234 --------------RTLSQSLAGA-------------------------VKRERKAAKTLGIAVG 259

  Fly   419 TFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFR 477
            .:::|||||.: .||..:......|.:|..|..|..||||..||:||.:..|.||:|.:
Mouse   260 IYLVCWLPFTV-DTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 59/182 (32%)
7tm_1 170..465 CDD:278431 95/299 (32%)
Taar5NP_001009574.1 7tm_1 51..305 CDD:278431 95/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.