DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Opn4

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_620215.1 Gene:Opn4 / 192223 RGDID:621701 Length:474 Species:Rattus norvegicus


Alignment Length:463 Identity:110/463 - (23%)
Similarity:185/463 - (39%) Gaps:105/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SSASNSSTGGIALPLGTATPATHELNATQ--PFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDN 150
            :|..|.|   :.:.|.:.:|.|..|.|..  ||         ....:.||.|:.           
  Rat    31 NSTQNIS---VRVQLLSVSPTTPGLQAAAWVPF---------PTVDVPDHAHYT----------- 72

  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
                 ...|:||:.:..:.|||.||.:..|.|.||...|..:::||::|.:::.......|:..:
  Rat    73 -----LGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINLAVSDFLMSFTQAPVFFASSL 132

  Fly   216 TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWIS 280
            ..:|.|....|..:......|...|::.|..|::|||..|.:||......:||...::||..|:.
  Rat   133 YKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLATIGMRSKRRTALVLLGVWLY 197

  Fly   281 PALLSFLPIFIGWYTTPQHQQFVIQN-PTQCSF------VVNKYYAVISSSISFWIPCTIMIFTY 338
             ||...||.|.||      ..:|.:. .|.||:      .:.:.|.::.....|::|..|:||.|
  Rat   198 -ALAWSLPPFFGW------SAYVPEGLLTSCSWDYVTFTPLVRAYTMLLFCFVFFLPLLIIIFCY 255

  Fly   339 LAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKM 403
            :.|||                      :::.:|.|..|.|.|             |.:.:...::
  Rat   256 IFIFR----------------------AIRETGRACEGCGES-------------PLRRRQWQRL 285

  Fly   404 KREHKAARTLGIIMGTFILCWLPF-------FLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLN 461
            :.|.|.|:...|::..|:|.|.|:       |..|:..:|.....||.::...       ::..|
  Rat   286 QSEWKMAKVALIVILLFVLSWAPYSTVALVGFAGYSHILTPYMSSVPAVIAKA-------SAIHN 343

  Fly   462 PLIYAYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDIRRS--SLRYDQRAKSVYS--ESYLNST 522
            |:|||..:..:|.|....|.||        .:.|.:..:||  ||.|....:|..|  .|.|:..
  Rat   344 PIIYAITHPKYRAAIAQHLPCL--------GVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWI 400

  Fly   523 TPSHRRQS 530
            :...|::|
  Rat   401 SGQKRQES 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 50/184 (27%)
7tm_1 170..465 CDD:278431 74/308 (24%)
Opn4NP_620215.1 7tm_4 78..>245 CDD:304433 46/173 (27%)
7tm_1 87..347 CDD:278431 74/308 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.