DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Ptger3

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001346674.1 Gene:Ptger3 / 19218 MGIID:97795 Length:366 Species:Mus musculus


Alignment Length:390 Identity:75/390 - (19%)
Similarity:133/390 - (34%) Gaps:103/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 HHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVI--TNYFVVS---L 195
            |..:.|:......|:...|..||.:.:::...: ||.|.::.|.|..:.|..  ...|::.   |
Mouse     9 HSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFV-GNALAMLLVSRSYRRRESKRKKSFLLCIGWL 72

  Fly   196 AMADIMVAIMAMTFNFSVQVT-GRW---NFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIV 256
            |:.|::..::.......|.:: .||   :.|..||..:......|..:|:|....::|:|..||.
Mouse    73 ALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLSSLLVASAMAVERALAIR 137

  Fly   257 KPLKYPISMTKRVVGIMLLNTWISPALLSFLPIF-IGWYTTPQHQQFVIQNP-TQCSFVVNKYYA 319
            .|..|...|..|....:||..|:|....:.||:. :|.|:        :|.| |.|         
Mouse   138 APHWYASHMKTRATRAVLLGVWLSVLAFALLPVLGVGRYS--------VQWPGTWC--------- 185

  Fly   320 VISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLT 384
                              :::.....|..:               |:.:|...|.:.:.:...|.
Mouse   186 ------------------FISTGPAGNETD---------------PAREPGSVAFASAFACLGLL 217

  Fly   385 LHEVEQEHTPTKDKHLIKMKREHKAA-----------------RTLGIIMGTFILCWLPFFLWYT 432
            ...|.........|.|:...|. |||                 :.:| ||....:||.|..:...
Mouse   218 ALVVTFACNLATIKALVSRCRA-KAAVSQSSAQWGRITTETAIQLMG-IMCVLSVCWSPLLIMML 280

  Fly   433 L----SMTCEECQVP--------DIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFC 485
            .    .|:.|:|:..        ..::::.  :...|..|:|.:|.        ..|..||..||
Mouse   281 KMIFNQMSVEQCKTQMGKEKECNSFLIAVR--LASLNQILDPWVYL--------LLRKILLRKFC 335

  Fly   486  485
            Mouse   336  335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 39/188 (21%)
7tm_1 170..465 CDD:278431 63/334 (19%)
Ptger3NP_001346674.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 2/12 (17%)
7tm_GPCRs 26..335 CDD:333717 70/371 (19%)
TM helix 1 28..52 CDD:320095 6/24 (25%)
TM helix 2 66..88 CDD:320095 3/21 (14%)
TM helix 3 108..130 CDD:320095 3/21 (14%)
TM helix 4 153..169 CDD:320095 4/15 (27%)
TM helix 5 204..227 CDD:320095 3/22 (14%)
TM helix 6 255..280 CDD:320095 6/25 (24%)
TM helix 7 302..327 CDD:320095 4/34 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.