DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and DRD1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_000785.1 Gene:DRD1 / 1812 HGNCID:3020 Length:446 Species:Homo sapiens


Alignment Length:346 Identity:124/346 - (35%)
Similarity:193/346 - (55%) Gaps:29/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 DNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLR-VITNYFVVSLAMADIMVAIMAMTFNFS 212
            |..|.:..|..:.|:|::.:.||.||..:|:|.|.|| .:||:||:|||::|::||::.|.:...
Human    19 DFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAV 83

  Fly   213 VQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNT 277
            .::.|.|.|..| |::|.:.|:..||||||:||.||||||:||..|.:|...||.:...|::...
Human    84 AEIAGFWPFGSF-CNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVA 147

  Fly   278 WISPALLSFLPIFIGWY----TTPQ--HQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIF 336
            |....|:||:|:.:.|:    |:|.  :...:.:....|...:::.||:.||.|||:||..|||.
Human   148 WTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIV 212

  Fly   337 TYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLI 401
            ||..|:|.|.:|.:::......|  :|..:.|.:      :|:.|.:   |..|..:..|    :
Human   213 TYTRIYRIAQKQIRRIAALERAA--VHAKNCQTT------TGNGKPV---ECSQPESSFK----M 262

  Fly   402 KMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVV-----SILFWIGYFNSTLN 461
            ..|||.|..:||.:|||.|:.||||||:...:...|...:.....:     .:..|.|:.||:||
Human   263 SFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLN 327

  Fly   462 PLIYAYFNRDFREAFRNTLLC 482
            |:||| ||.|||:||...|.|
Human   328 PIIYA-FNADFRKAFSTLLGC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 72/184 (39%)
7tm_1 170..465 CDD:278431 107/306 (35%)
DRD1NP_000785.1 7tmA_D1A_dopamine_R 23..341 CDD:320443 118/334 (35%)
TM helix 1 26..50 CDD:320443 8/23 (35%)
TM helix 2 60..82 CDD:320443 10/21 (48%)
TM helix 3 97..119 CDD:320443 11/21 (52%)
TM helix 4 142..158 CDD:320443 5/15 (33%)
TM helix 5 192..215 CDD:320443 13/22 (59%)
TM helix 6 271..293 CDD:320443 12/21 (57%)
TM helix 7 310..335 CDD:320443 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.