DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Mtnr1a

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_032665.1 Gene:Mtnr1a / 17773 MGIID:102967 Length:353 Species:Mus musculus


Alignment Length:393 Identity:101/393 - (25%)
Similarity:157/393 - (39%) Gaps:106/393 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LNATQ--PFGGSGLNFNESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLV 174
            |||||  |.||.|                  ..|...||.:.:    ||:::..|:..|.|||||
Mouse     9 LNATQQAPGGGEG------------------GRPRPSWLASTL----AFILIFTIVVDILGNLLV 51

  Fly   175 IISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTA 239
            |:||.|.:|||...|.||||||:||::||:.......:..:...||.....|.:...|.......
Mouse    52 ILSVYRNKKLRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQVSAFLMGLSVIG 116

  Fly   240 SILHLCCISVDRYYAIVKPLKY-PISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTT-----PQ 298
            ||.::..|:::||..|...||| .|...|.                |...:|:.|..|     |.
Mouse   117 SIFNITGIAMNRYCYICHSLKYDKIYSNKN----------------SLCYVFLIWMLTLIAIMPN 165

  Fly   299 HQQFVIQ-NPT--QCSFV--VNKYYAVISSSISFWIPCTIMIFTYLAIF---REANRQEKQLMMR 355
            .|...:| :|.  .|:|.  |:..|.:......|.:|..|:||.||.|:   .:..|:.|.    
Mouse   166 LQTGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRRRVKP---- 226

  Fly   356 HGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTF 420
                  .::|.::|                                   ::.:...|:.::...|
Mouse   227 ------DNKPKLKP-----------------------------------QDFRNFVTMFVVFVLF 250

  Fly   421 ILCWLPFFLWYTLSMTCEECQVPDI-----VVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTL 480
            .:||.|..|...:..:.....||.|     |.|  :::.||||.||.:||...|::||:.::..:
Mouse   251 AICWAPLNLIGLIVASDPATMVPRIPEWLFVAS--YYLAYFNSCLNAIIYGLLNQNFRKEYKKII 313

  Fly   481 LCL 483
            :.|
Mouse   314 VSL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 59/188 (31%)
7tm_1 170..465 CDD:278431 79/313 (25%)
Mtnr1aNP_032665.1 7tm_4 38..>160 CDD:304433 44/137 (32%)
7tm_1 47..298 CDD:278431 79/313 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.