DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Htr2a

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_766400.1 Gene:Htr2a / 15558 MGIID:109521 Length:471 Species:Mus musculus


Alignment Length:387 Identity:112/387 - (28%)
Similarity:194/387 - (50%) Gaps:39/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 HNPDEDWLDNIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIM 205
            |..:::|        .|.:..::||..|.||:|||::|...:||:..||||::|||:||:::..:
Mouse    70 HLQEKNW--------SALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFL 126

  Fly   206 AMTFNFSVQVTG-RWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRV 269
            .|..:....:.| ||.....||.:|..|||.||||||:|||.||:|||.||..|:.:....::..
Mouse   127 VMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTK 191

  Fly   270 VGIMLLNTW-ISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTI 333
            ..:.::..| ||..:...:|:|     ..|....|.:..: | .:.:..:.:|.|.::|:||.||
Mouse   192 AFLKIIAVWTISVGISMPIPVF-----GLQDDSKVFKEGS-C-LLADDNFVLIGSFVAFFIPLTI 249

  Fly   334 MIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDK 398
            |:.||....:...::....:     :.|..|..:.........|.||:.|....:.:|......:
Mouse   250 MVITYFLTIKSLQKEATLCV-----SDLSTRAKLSSFSFLPQSSLSSEKLFQRSIHREPGSYAGR 309

  Fly   399 HLIK-MKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEE-C--QVPDIVVSILFWIGYFNST 459
            ..:: :..|.||.:.|||:...|::.|.|||:...:::.|:| |  .|...::::..||||.:|.
Mouse   310 RTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGALLNVFVWIGYLSSA 374

  Fly   460 LNPLIYAYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDI---------RRSSLRYDQRAKS 512
            :|||:|..||:.:|.||...:.|.:    |:...||.:.:         :.|.|:..|:..|
Mouse   375 VNPLVYTLFNKTYRSAFSRYIQCQY----KENRKPLQLILVNTIPTLAYKSSQLQVGQKKNS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 65/179 (36%)
7tm_1 170..465 CDD:278431 92/300 (31%)
Htr2aNP_766400.1 7tm_4 89..>207 CDD:304433 48/117 (41%)
7tm_1 91..380 CDD:278431 92/300 (31%)
Agonist binding. /evidence=ECO:0000250|UniProtKB:P41595 155..160 3/4 (75%)
DRY motif, important for ligand-induced conformation changes. /evidence=ECO:0000250|UniProtKB:P41595 172..174 1/1 (100%)
Agonist binding. /evidence=ECO:0000250|UniProtKB:P41595 336..340 2/3 (67%)
NPxxY motif, important for ligand-induced conformation changes and signaling. /evidence=ECO:0000250|UniProtKB:P41595 376..380 3/3 (100%)
PDZ-binding. /evidence=ECO:0000250|UniProtKB:P28223 469..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.