DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and TAAR9

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_778227.3 Gene:TAAR9 / 134860 HGNCID:20977 Length:348 Species:Homo sapiens


Alignment Length:362 Identity:110/362 - (30%)
Similarity:159/362 - (43%) Gaps:72/362 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLCDLW 229
            :.|..|||||:|:::..::|...||:.:.|||.||.:|.:..|.|:....|...|.|....|...
Human    44 VLAAFGNLLVMIAILHFKQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFH 108

  Fly   230 NSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWY 294
            ...|..|..||:.||||||||||.|:..||.||...|..|.||.::.:|......|| .||   |
Human   109 TCFDTSFCFASLFHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYSF-SIF---Y 169

  Fly   295 TTPQH---QQFVIQNPT--QCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMM 354
            |....   ::.|:....  .|...:|:.: |:...:.|:||...|:|.|..||..|..|.:::  
Human   170 TGANEEGIEELVVALTCVGGCQAPLNQNW-VLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKI-- 231

  Fly   355 RHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGT 419
                        ...:.:|.|.|.|.|...                  .|||.|||:||||.|..
Human   232 ------------ESTASQAQSSSESYKERV------------------AKRERKAAKTLGIAMAA 266

  Fly   420 FILCWLPFFL-----WYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNT 479
            |::.|||:.:     .|...:|      |..|..||.|..|:||.:||||||:|.:.|.:|.:  
Human   267 FLVSWLPYLVDAVIDAYMNFIT------PPYVYEILVWCVYYNSAMNPLIYAFFYQWFGKAIK-- 323

  Fly   480 LLCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSE 516
                             :.:....||.|....:::||
Human   324 -----------------LIVSGKVLRTDSSTTNLFSE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 62/181 (34%)
7tm_1 170..465 CDD:278431 98/304 (32%)
TAAR9NP_778227.3 7tm_4 43..>271 CDD:304433 83/263 (32%)
7tm_1 49..311 CDD:278431 98/304 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.