DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and ADORA1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_000665.1 Gene:ADORA1 / 134 HGNCID:262 Length:326 Species:Homo sapiens


Alignment Length:370 Identity:91/370 - (24%)
Similarity:155/370 - (41%) Gaps:94/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 VMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSP 223
            :.:||.:.::.||:|||.:|...:.||..|..|:||||:||  ||:.|:....::.:    |..|
Human    15 IEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVAD--VAVGALVIPLAILI----NIGP 73

  Fly   224 FLCDLWNSLDVYFST-------------ASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLL 275
                     ..||.|             :|||.|..|:||||..:..||:|.:.:|.|...:.:.
Human    74 ---------QTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIA 129

  Fly   276 NTWISPALLSFLPIFIGWYTTPQHQQFVIQNPT------QCSF--VVNKYYAVISSSISFWI--P 330
            ..||...::...|:| ||......::....|.:      :|.|  |::..| ::..:...|:  |
Human   130 GCWILSFVVGLTPMF-GWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEY-MVYFNFFVWVLPP 192

  Fly   331 CTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPT 395
            ..:|:..||.:|....:|             :::.....||:.....|                 
Human   193 LLLMVLIYLEVFYLIRKQ-------------LNKKVSASSGDPQKYYG----------------- 227

  Fly   396 KDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTL 460
                     :|.|.|::|.:|:..|.|.|||..:...:::.|..|..|.|:..|..::.:.||.:
Human   228 ---------KELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAM 283

  Fly   461 NPLIYAYFNRDFREAFRNTLLCLFCNWWKDRHL------PLDIDI 499
            ||::||:..:.||..|...        |.| |.      |:|.|:
Human   284 NPIVYAFRIQKFRVTFLKI--------WND-HFRCQPAPPIDEDL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 54/200 (27%)
7tm_1 170..465 CDD:278431 78/317 (25%)
ADORA1NP_000665.1 7tm_4 18..>137 CDD:304433 42/133 (32%)
7tm_1 26..288 CDD:278431 78/317 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.