DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and GPRSMS

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_320274.2 Gene:GPRSMS / 1280421 VectorBaseID:AGAP012268 Length:332 Species:Anopheles gambiae


Alignment Length:362 Identity:84/362 - (23%)
Similarity:153/362 - (42%) Gaps:71/362 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGR 218
            |....:..|:.|..:.||.|||..|:|..|::.:||.::::||:|| ...::.:.|..:....|.
Mosquito     6 VISMILYALVAIVGLFGNTLVIYVVLRFSKMQTVTNMYILNLAIAD-QCFLIGIPFLITTMHLGE 69

  Fly   219 WNFSPFLCDLWN-SLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPA 282
            |.|...:|..:. |..:...|:||. |..:|.|||.|:..|:..|...|..|..::....|.:.|
Mosquito    70 WTFGNAMCKAYMVSTSITQFTSSIF-LFIMSADRYIAVCHPISSPRFRTPLVSKVVSAIAWTASA 133

  Fly   283 LLSFLPIFIGWYTTPQHQQFVIQN---PTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFRE 344
            |: .||:.:...|..:.:..:..|   |::........:.:.|..:.|.||.|:::..|..:.|:
Mosquito   134 LI-MLPVMLYANTIAREKDKMSCNIMWPSETGANSGSTFTLYSLILGFAIPLTLILMFYYLVIRK 197

  Fly   345 ANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREH-K 408
            ..                   ::.|..:                      :|:|     ||.| |
Mosquito   198 LR-------------------TVGPKSK----------------------SKEK-----KRSHRK 216

  Fly   409 AARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDI--------VVSILFWIGYFNSTLNPLIY 465
            ..:.:..::..::|||||    |.:|........|||        |..::.|:||.||.:||::|
Mosquito   217 VTKLVLTVITVYVLCWLP----YWISQVALINSPPDICKSRLEITVFVLVSWLGYSNSAMNPILY 277

  Fly   466 AYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDIRRS 502
            |:.:.:|:::|.....|.     |.:.:...:.|..|
Mosquito   278 AFLSDNFKKSFLKACTCA-----KGKEINAQLQIENS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 48/181 (27%)
7tm_1 170..465 CDD:278431 73/307 (24%)
GPRSMSXP_320274.2 7tm_4 14..>136 CDD:304433 38/124 (31%)
7tm_1 22..277 CDD:278431 73/307 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.