DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and GPRNPR2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_314808.3 Gene:GPRNPR2 / 1275552 VectorBaseID:AGAP008702 Length:268 Species:Anopheles gambiae


Alignment Length:253 Identity:55/253 - (21%)
Similarity:112/253 - (44%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 IMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNK------YYAVISSSISFWIP 330
            ::::..||:.|:.| :|.|| :..|..:.....|..|.|  :||:      .:.:|:.::.:.:|
Mosquito     7 LVIVAVWITSAVYS-IPKFI-FVRTITNNLSDDQLETIC--IVNRKMFNSELFDIINFALLYLLP 67

  Fly   331 CTIMIFTYL------AIFREANRQEKQLMMRHGNAML----MHR-PSMQPSGEALSGSGSSKTLT 384
            ..:|..:.|      |:::.:...|:.:.:::..:..    .|| ||.:........:.|..:::
Mosquito    68 LLVMTVSVLYSRIAIALWKSSRGLERHIALQNTTSSSYSSNFHRKPSSKYDKRTTGVTESQVSVS 132

  Fly   385 L-------------------HEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFF-- 428
            :                   |..:.........::::.:|  ...|.|.:::.||.||.|||.  
Mosquito   133 VESDKVVVTTWPAQNSFHQRHGTQLTQVSHSSNNVLRARR--GVIRMLMVVVLTFALCNLPFHAR 195

  Fly   429 -LWYTLSMTCE-ECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLF 484
             :|...|...: :.....:...:.|.:.||||.:|||:||:.:|:||:..|..|||.|
Mosquito   196 KMWQYWSTDYKGDSNFNALFTPLTFLVTYFNSGVNPLLYAFLSRNFRKGMRELLLCSF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 18/81 (22%)
7tm_1 170..465 CDD:278431 45/232 (19%)
GPRNPR2XP_314808.3 7tm_1 <159..234 CDD:278431 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.