DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and OR4D2

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001004707.1 Gene:OR4D2 / 124538 HGNCID:8294 Length:307 Species:Homo sapiens


Alignment Length:374 Identity:83/374 - (22%)
Similarity:135/374 - (36%) Gaps:125/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NIVWV----------------FKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMA 198
            |:.||                |...:.|.:.|..:.||:|:||:|....:|.....:.:.:||:.
Human     5 NLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMYFLLRNLAVL 69

  Fly   199 DI----------MVAIMAMTFNFSVQ-VTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRY 252
            |:          :|.:::.....|.| ..|:..|..||           ..|.:..|..::.||.
Human    70 DLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFL-----------GGAMVFFLSVMAFDRL 123

  Fly   253 YAIVKPLKYPISM-TKRVVGIMLLNTWISP--------ALLSFLPIFIG-------WYTTPQHQQ 301
            .||.:||:|...| |:..||:::. ||:..        ||:..|| |.|       :...||..:
Human   124 IAISRPLRYVTVMNTQLWVGLVVA-TWVGGFVHSIVQLALMLPLP-FCGPNILDNFYCDVPQVLR 186

  Fly   302 FVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAMLMHRPS 366
            ....:.:...|:     .:.:|.:...:...:::.:||.|.                .||...| 
Human   187 LACTDTSLLEFL-----KISNSGLLDVVWFFLLLMSYLFIL----------------VMLRSHP- 229

  Fly   367 MQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWY 431
                |||...:.|  |.|.|                            ||:.:.|  ::|....|
Human   230 ----GEARRKAAS--TCTTH----------------------------IIVVSMI--FVPSIYLY 258

  Fly   432 TLSMTCEECQVP-DIVVSILFWIGYFNST--LNPLIYAYFNRDFREAFR 477
            ....|    ..| |.:||    ||:...|  |||:||...|:|.:.|.|
Human   259 ARPFT----PFPMDKLVS----IGHTVMTPMLNPMIYTLRNQDMQAAVR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 45/204 (22%)
7tm_1 170..465 CDD:278431 71/324 (22%)
OR4D2NP_001004707.1 7tm_4 31..301 CDD:304433 79/348 (23%)
7tm_1 41..287 CDD:278431 71/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.