DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and CMKLR1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001135815.1 Gene:CMKLR1 / 1240 HGNCID:2121 Length:373 Species:Homo sapiens


Alignment Length:435 Identity:89/435 - (20%)
Similarity:153/435 - (35%) Gaps:140/435 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DE--DWLDNIV-------------WVFKAFVMLLIIIAAICGN-LLVIISVMRVRKLRVITNYFV 192
            ||  |:||:||             .:|...|..::....|.|| |::||:..:::|  .:...:.
Human    16 DEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKK--TVNMVWF 78

  Fly   193 VSLAMAD--------IMVAIMAMTFNFSVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISV 249
            ::||:||        |.:...||.::        |.|...:|.:.|.|.::....|:..|..||.
Human    79 LNLAVADFLFNVFLPIHITYAAMDYH--------WVFGTAMCKISNFLLIHNMFTSVFLLTIISS 135

  Fly   250 DRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQH------QQFVIQNPT 308
            ||..:::.|:......:.|:..:..:..|:....|| .|..:...|...|      ..|.:..|.
Human   136 DRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLS-SPSLVFRDTANLHGKISCFNNFSLSTPG 199

  Fly   309 QCSFVVNKYYAVISSS-----------ISFWIPCTIMIFTYLAIFREANRQEKQLMMRHGNAMLM 362
            ..|:..:.....:..|           ..|.:|..|:...||.|..:..|               
Human   200 SSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQR--------------- 249

  Fly   363 HRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPF 427
                                               ..|.|.|:..|...|:.|   ||.|||.|:
Human   250 -----------------------------------NRLAKTKKPFKIIVTIII---TFFLCWCPY 276

  Fly   428 FLWYTLS-MTCEECQVPDIVVS----ILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFCNW 487
               :||: :......:|..|.|    :...:...||.:||::|.:..:||:: |:   :.||   
Human   277 ---HTLNLLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKK-FK---VALF--- 331

  Fly   488 WKDRHLPLDIDIRRSSLRYDQRAKSVYSESYLNSTTPSHRRQSQM 532
                                .|..:..||...:|:.||||..::|
Human   332 --------------------SRLVNALSEDTGHSSYPSHRSFTKM 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 42/203 (21%)
7tm_1 170..465 CDD:278431 64/325 (20%)
CMKLR1NP_001135815.1 7tmA_CMKLR1 41..327 CDD:320244 70/353 (20%)
TM helix 1 42..68 CDD:320244 8/25 (32%)
TM helix 2 74..99 CDD:320244 5/24 (21%)
TM helix 3 112..142 CDD:320244 9/29 (31%)
TM helix 4 154..174 CDD:320244 4/20 (20%)
TM helix 5 217..242 CDD:320244 4/24 (17%)
TM helix 6 253..283 CDD:320244 13/35 (37%)
TM helix 7 295..320 CDD:320244 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..373 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.