DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and Taar1

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_599155.1 Gene:Taar1 / 113914 RGDID:621621 Length:332 Species:Rattus norvegicus


Alignment Length:332 Identity:105/332 - (31%)
Similarity:160/332 - (48%) Gaps:59/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFSPFLC 226
            |||:..:.|||:||||:...::|...||:.:.|:|:.|.::..:.|.::....|...|.|....|
  Rat    31 LIILTTLVGNLIVIISISHFKQLHTPTNWLLHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFC 95

  Fly   227 DLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFI 291
            .|..|.|:..|:||||||..||:|||||:..||:|...:....:.:|:|.:|..||:.:|..||:
  Rat    96 KLHTSTDIMLSSASILHLAFISIDRYYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFL 160

  Fly   292 -----GWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQ 351
                 |......:|.|.::.   |....:|...|::...||:||.::|:|.|..|:         
  Rat   161 ELNLEGVEEQYHNQVFCLRG---CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIY--------- 213

  Fly   352 LMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGII 416
             .:..|.|..::|.::|...|..|.:..||                        |.|||:||||:
  Rat   214 -FIAKGQARSINRANLQVGLEGESRAPQSK------------------------ETKAAKTLGIM 253

  Fly   417 MGTFILCWLPF--------FLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFR 473
            :|.|:|||.||        ||.|.         :|..:...|.|.||.||..||::||:|...||
  Rat   254 VGVFLLCWCPFFFCMVLDPFLGYV---------IPPTLNDTLNWFGYLNSAFNPMVYAFFYPWFR 309

  Fly   474 EAFRNTL 480
            .|.:..|
  Rat   310 RALKMVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 60/182 (33%)
7tm_1 170..465 CDD:278431 95/307 (31%)
Taar1NP_599155.1 7tm_4 30..>164 CDD:304433 49/132 (37%)
7tm_1 39..301 CDD:278431 95/307 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.