DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and taar20w

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_009303898.1 Gene:taar20w / 103911778 ZFINID:ZDB-GENE-060414-8 Length:332 Species:Danio rerio


Alignment Length:326 Identity:90/326 - (27%)
Similarity:154/326 - (47%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
            |:::|.:.:....:..    |||||||:...:||...||..::|||:.|:::.:: |......|.
Zfish    33 IIYLFASLLSAWTVFL----NLLVIISISHFKKLHTPTNMIILSLAVNDLLIGVV-MPIEAIRQT 92

  Fly   216 TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYP--ISMTKRVVGIMLLNTW 278
            ...|.|....|.|:........:||:.:|..|:||||.|:..||.||  |::||.::.|.|...|
Zfish    93 ETCWYFGNIFCGLYLLFISLLMSASLSNLVLIAVDRYVAVCHPLLYPQKITITKTLMIICLSWVW 157

  Fly   279 ISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFR 343
            :|...::.| |..|::.|.....   :...:|..:::..:.:....:||..||.:::..||.||.
Zfish   158 LSAYSIALL-INNGYFDTSHRSD---ECYGECLAIISFSWIITDLFMSFMFPCPLIMMLYLRIFY 218

  Fly   344 EANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHK 408
            ..::|.|.:            .|:...|:.:: .||                     :|.|.|.|
Zfish   219 VVHQQVKVI------------NSLMKGGKCVT-EGS---------------------VKRKSESK 249

  Fly   409 AARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFR 473
            ||.|||||:..::|||:|:::       |....:....:.::.|..|.||.||||:||.|...|:
Zfish   250 AALTLGIIVAVYMLCWIPYYI-------CSLIVISSTAMIVIIWAVYANSALNPLVYALFYPWFK 307

  Fly   474 E 474
            :
Zfish   308 K 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 52/179 (29%)
7tm_1 170..465 CDD:278431 84/296 (28%)
taar20wXP_009303898.1 7tm_4 46..>178 CDD:304433 45/137 (33%)
7tm_1 49..299 CDD:278431 84/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.