DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and gpr6

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_003200829.1 Gene:gpr6 / 100538060 -ID:- Length:333 Species:Danio rerio


Alignment Length:390 Identity:94/390 - (24%)
Similarity:146/390 - (37%) Gaps:112/390 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NESGAGLSDHHHHQQHNPDEDWLDNIVWVFKAF----------------VMLLI---IIAAICGN 171
            |||..|.          |...||:...:.....                :||.:   :||  |.|
Zfish     9 NESAMGF----------PSSSWLEAETFASNGTLALSSASPNFHVNPWDIMLCLSGTVIA--CEN 61

  Fly   172 LLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQ----------VTGRWNFSPFLC 226
            .:|:..:.....||......:.|||.||:: |.|.:..||:.|          :|..:..:.|  
Zfish    62 AIVVAIIFYTPTLRNPMFVLIGSLATADLL-AGMGLILNFAFQYLVSSETISLITVGFLVASF-- 123

  Fly   227 DLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFI 291
                       ||||..|..|:||||.::...|.|....|...|.:||:.||.:...|..||: :
Zfish   124 -----------TASISSLLAITVDRYLSLYNALTYFSEKTLHYVHLMLVGTWGASLCLGLLPV-L 176

  Fly   292 GWYTTPQHQQFVIQNPTQCSFV-VNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQLMMR 355
            ||.        .:.:.:.||.| ..|...:...:.||:|...:|:..|..|.:        ::.|
Zfish   177 GWN--------CLDDASTCSIVRPLKRSNLTLLATSFFIIFILMLSLYFKICK--------IVCR 225

  Fly   356 HGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTF 420
            |.:.:.:                           |:|..| ..|.:..|   |...||.||:|||
Zfish   226 HAHQIAL---------------------------QQHFFT-TSHYVATK---KGVSTLAIILGTF 259

  Fly   421 ILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLCLFC 485
            ...||||.::..:.    |.:.|.:..........:||.:||:||||.|.:.:.:..    .|||
Zfish   260 GASWLPFAIYCLVG----EREYPPVYTYATLLPATYNSMINPIIYAYRNTEIQRSIH----MLFC 316

  Fly   486  485
            Zfish   317  316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 51/188 (27%)
7tm_1 170..465 CDD:278431 74/305 (24%)
gpr6XP_003200829.1 7tm_4 50..316 CDD:304433 84/337 (25%)
7tm_1 60..300 CDD:278431 74/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.