DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and taar18g

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:XP_009303908.2 Gene:taar18g / 100330560 ZFINID:ZDB-GENE-060413-11 Length:349 Species:Danio rerio


Alignment Length:338 Identity:105/338 - (31%)
Similarity:159/338 - (47%) Gaps:64/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVF----KAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNF 211
            |::||    .|:.:.|        |||||||:...:||...||..::|||:.|:::. :||....
Zfish    51 IMYVFFSLLSAWTVFL--------NLLVIISISHFKKLHTPTNMIILSLAVNDLLIG-LAMPIEA 106

  Fly   212 SVQVTGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYP--ISMTKRVVGIML 274
            ...|...|.|....|.|:..:....|:||:.:|..|:||||.|:...|.||  |:||...|.|.|
Zfish   107 FRLVDTCWYFGELFCGLFLIVMALLSSASLSNLVLIAVDRYVAVCHSLLYPQKITMTNVFVSICL 171

  Fly   275 LNTWISPALLSFLPIFI--GWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFT 337
              .|  ...|::..:|:  ..|.....::.|...  :|....:..|.:|....||.:||.:||..
Zfish   172 --CW--SFSLTYCTVFVVNNTYLDTSSRKRVCYG--ECILHFSFTYVIIDEIYSFLLPCVVMITV 230

  Fly   338 YLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIK 402
            ||.||..|.:|.|.:            .|:...|:.:. .||                     :|
Zfish   231 YLRIFCVAIKQVKVI------------NSLMKGGKCVK-EGS---------------------VK 261

  Fly   403 MKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPLIYAY 467
            .|.|||||.||||::..::||::|::|   :|:|    .|....::.|.|..|.||.|||||||.
Zfish   262 RKSEHKAALTLGIVVTVYLLCYIPYYL---ISLT----GVYSKTITYLLWTLYVNSGLNPLIYAL 319

  Fly   468 FNRDFREAFRNTL 480
            |.|.|:.:.::.|
Zfish   320 FYRWFKTSVKHIL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 57/181 (31%)
7tm_1 170..465 CDD:278431 93/298 (31%)
taar18gXP_009303908.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.