DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and ccr3

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001107334.1 Gene:ccr3 / 100135154 XenbaseID:XB-GENE-5897823 Length:345 Species:Xenopus tropicalis


Alignment Length:391 Identity:74/391 - (18%)
Similarity:149/391 - (38%) Gaps:112/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 FVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQVTGRWNFS 222
            |....:...::.||.|::..:::..|::.:||.|:::|.::|::..|....:.|  ..:..|.|.
 Frog    46 FFYYTVFTLSLLGNGLILFLLLKYEKIKTVTNLFILNLVISDLLFTITLPFWAF--YHSNEWVFG 108

  Fly   223 PFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIML--LNTWISPALLS 285
            ..:|.:.:|:......:.||.|..:::|||.|:|..:.  .:.|::::.:.:  :..|:. :.:|
 Frog   109 NGMCKVVSSVFFIGFFSCILFLTVMTMDRYLAVVHAVS--AARTRKLIYVYVASIAIWVI-SFVS 170

  Fly   286 FLPIFIGWYTTPQHQQFVIQNPTQCSFVVNK--------YYAVISSSISFWIPCTIMIFTYLAIF 342
            .:|.|: .|.|.:|....|. ..:..|..:|        ||..:  ::.|..|..::::.|    
 Frog   171 TVPKFV-LYGTRKHDSAGIL-CEETGFSADKIDTWRRLGYYQQL--TMFFLFPLIVILYCY---- 227

  Fly   343 REANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREH 407
                                                     ||..|:..:|        ||..:.
 Frog   228 -----------------------------------------TLIVVKLFNT--------KMHNKD 243

  Fly   408 KAARTLGIIMGTFILCWLPF----FLWYTLSMTCEECQVPDIVVSILFW----IGYFNSTLNPLI 464
            ||.:.:.:|:..|.:||.|:    ||..:....|.:      .::..|:    |.||:..:||..
 Frog   244 KAVKLISVIVLAFFICWTPYNVVIFLRLSPGDPCND------YLNNAFYICRNIAYFHCCINPFF 302

  Fly   465 YAYFNRDFREAFRNTLLCLFCNWWKDRHLPLDIDIRRSSLRYDQRAKSVYSESYLNSTTPSHRRQ 529
            |.:....||                 |||         |........|::..|..:|.|..:..|
 Frog   303 YTFVGTKFR-----------------RHL---------SALLGTNCLSMFRRSSSSSRTSEYSPQ 341

  Fly   530 S 530
            :
 Frog   342 T 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 39/187 (21%)
7tm_1 170..465 CDD:278431 61/312 (20%)
ccr3NP_001107334.1 7tm_1 58..303 CDD:278431 61/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.