DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octbeta2R and hrh2b

DIOPT Version :9

Sequence 1:NP_001163596.2 Gene:Octbeta2R / 41549 FlyBaseID:FBgn0038063 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001103208.1 Gene:hrh2b / 100005590 ZFINID:ZDB-GENE-070928-20 Length:335 Species:Danio rerio


Alignment Length:344 Identity:106/344 - (30%)
Similarity:169/344 - (49%) Gaps:57/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVITNYFVVSLAMADIMVAIMAMTFNFSVQV 215
            :.||    |::..|...||||:||.::|...|:|..:::.|::|||:.|:::.::.:..:..:::
Zfish     6 LCWV----VLVAFIALTICGNILVCMAVATSRRLHQLSSCFILSLAVTDLLLGLLVLPLSAMLEL 66

  Fly   216 -TGRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWI 279
             .|:|......|:::.|:||..|:||||.|..||||||.||..||.||..:|.|.|.|.|...|.
Zfish    67 RNGKWPLGGVFCNIYISMDVMLSSASILTLLAISVDRYLAISNPLFYPRRVTPRRVAIALTAIWT 131

  Fly   280 SPALLSFLPIFIGWYTTPQHQQFVIQN-----------PTQCSFVVNKYYAVISSSISFWIPCTI 333
            ....:||:.|.:|| .:|   .|.:||           ...|.:..|..|.::.:...|::|..:
Zfish   132 CSLAVSFVSINLGW-NSP---DFRVQNLDWSMWGEGEEGRTCRYEWNNNYVLLKAFGIFYLPLLV 192

  Fly   334 MIFTYLAIFREANRQEKQLMMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDK 398
            |...|..||..|..|.:::           |.:...|.:|.:.:.::                  
Zfish   193 MCGMYHRIFCVAREQVRRI-----------RAATPSSAQAANAAATA------------------ 228

  Fly   399 HLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEECQVPDIVVSILFWIGYFNSTLNPL 463
                  |||||..||..::|.||:||.|:|.::|. |.........:..||:.|:||.||.|||:
Zfish   229 ------REHKATVTLAAVLGAFIICWFPYFTYFTY-MGMWAIHPNKLTHSIVLWLGYLNSALNPI 286

  Fly   464 IYAYFNRDFREAFRNTLLC 482
            :|...||||.:|. ..|||
Zfish   287 LYPALNRDFHQAC-GQLLC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octbeta2RNP_001163596.2 7tm_4 164..>342 CDD:304433 61/189 (32%)
7tm_1 170..465 CDD:278431 91/306 (30%)
hrh2bNP_001103208.1 7tm_1 21..288 CDD:278431 91/306 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.