DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5961 and FBP7

DIOPT Version :9

Sequence 1:NP_001189211.1 Gene:CG5961 / 41541 FlyBaseID:FBgn0038056 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001320240.1 Gene:FBP7 / 838780 AraportID:AT1G21760 Length:328 Species:Arabidopsis thaliana


Alignment Length:257 Identity:67/257 - (26%)
Similarity:105/257 - (40%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GLHFADLP------------PEIVMRI----LRWVVSAQLDMRSLEQCAAVCKGFYVYARDEELW 224
            |:|...:|            |.::.|.    |.:.|.|::....|.:.:.||:.:....|:...|
plant    35 GVHVRPVPPFGSTSRKPHFDPALIHRCLPDELLFEVFARMMPYDLGRASCVCRKWRYTVRNPMFW 99

  Fly   225 RLACVKVWGHNVGTLEAQDSDVSNVFHSWRDMFIRRDRVLFNGCYISKTTYLRMGENSFQDQFYR 289
            |.||:|.| ...|.:|......|....|||.|::.|.||..:|.|:|:.||:|.|...:  :...
plant   100 RNACLKAW-QTAGVIENYKILQSKYDGSWRKMWLLRSRVRTDGLYVSRNTYIRAGIAEW--KITN 161

  Fly   290 PVQLVEYYRYIRFLPDGKVLMMTTADEPAQGVSKLKHV---NNVRAEMLRGRYRLFGSTVTLVLQ 351
            ||.:|.|||||||.|.|:.|...::       .|||.|   .|.:|......|:   .|.||.:.
plant   162 PVHIVCYYRYIRFYPSGRFLYKNSS-------QKLKDVAKYMNFKASKSENLYK---GTYTLSMS 216

  Fly   352 KSQQRGPANVRQRRGSIMPVDEDSSQFLIELRIAGTTKRRCAQLVWSHYTLVQKRNKVDISS 413
            ..:..........|.:::         .|.||:.||.              :...|::|:.|
plant   217 DDKIEAAVLYPGTRPTVL---------RIRLRLRGTA--------------IGANNRMDLLS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5961NP_001189211.1 MIT 74..131 CDD:294211
F-box-like 179..225 CDD:289689 10/61 (16%)
FBP7NP_001320240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2997
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407789at2759
OrthoFinder 1 1.000 - - FOG0005835
OrthoInspector 1 1.000 - - oto3287
orthoMCL 1 0.900 - - OOG6_104095
Panther 1 1.100 - - LDO PTHR12874
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4819
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.