DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5961 and LOC101732478

DIOPT Version :9

Sequence 1:NP_001189211.1 Gene:CG5961 / 41541 FlyBaseID:FBgn0038056 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_004914495.1 Gene:LOC101732478 / 101732478 -ID:- Length:417 Species:Xenopus tropicalis


Alignment Length:398 Identity:72/398 - (18%)
Similarity:146/398 - (36%) Gaps:118/398 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LYRTAVQLEQRGKVYDALPFYRKATQIVPDIEFRFYEQQKQKLSNDVSKKYLNLANDLAKQLDLG 134
            |..||:||::   ::|::.. .|:.:::         ::..:|......::..|.:.:...|:..
 Frog     9 LVETALQLQE---LHDSISL-SKSERLI---------RRTGRLKQWQLDRFPPLCSSVTHSLENK 60

  Fly   135 QSDGEEVVDNLYEKFQHDLRQKN-IYNGKMIASSRDA---NVLTTGLHFADLPPEIVMRILRWVV 195
            ::...|.|.      :.|:.|.| :.|..:..:.:|.   ::|.:.....||  .:|..:|:...
 Frog    61 KTSLHEAVR------RGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDL--ALVKYLLQKGA 117

  Fly   196 SAQL-DMRS------------------LEQCAAVCKGFYVYARDEEL------WRLACVKVWGHN 235
            |..| |:||                  |.||.|: .....|..:..|      ..|.|||:...|
 Frog   118 SVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGAL-PDIVNYCGETPLHLAAANGHLLCVKILIQN 181

  Fly   236 VGTLEAQDSDVSNVFHSWRDMFIRRDRVLFNGCYISKTTYLRMGENSFQDQFYRPVQLVEYYRYI 300
            ..:::.:|:      :.|..:         ..|             |..||    :.::||.   
 Frog   182 KASIDIKDN------NKWTPL---------QWC-------------SINDQ----IDVLEYL--- 211

  Fly   301 RFLPDGKVLMMTTADEPAQGVSKLKHVNNVRAEMLRGRYRLFGSTVTL---------VLQKSQQR 356
                   |.:..:.:|.:.....|.|::.:...:....| |..:.|.:         .|..:.:.
 Frog   212 -------VSLGASLEEKSTTGMTLLHLSALAGNLQVINY-LLNTNVDINVKDINGLTALHLAAEN 268

  Fly   357 GPANVRQ---RRGSIMPVDEDSSQFLIELRIAGTTKRRCAQLVWSHYTLVQKR----NKVDISSE 414
            |.:.:.:   ::|:|:.: .|.:......|.||   |...::|    ||:.|:    |.:||.:.
 Frog   269 GHSKIIKCLLKKGAIVNI-TDINHLTPLHRAAG---RGYTEIV----TLLLKQKAAVNNMDIQNL 325

  Fly   415 FDLTEAKY 422
            ..|..|.|
 Frog   326 TPLHHAAY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5961NP_001189211.1 MIT 74..131 CDD:294211 7/56 (13%)
F-box-like 179..225 CDD:289689 15/70 (21%)
LOC101732478XP_004914495.1 Ank_4 62..113 CDD:372654 11/58 (19%)
ANK repeat 62..90 CDD:293786 6/33 (18%)
ANK repeat 92..123 CDD:293786 7/32 (22%)
PHA03095 105..>375 CDD:222980 54/283 (19%)
ANK repeat 125..156 CDD:293786 6/31 (19%)
ANK repeat 158..189 CDD:293786 6/30 (20%)
ANK repeat 191..219 CDD:293786 8/63 (13%)
ANK repeat 227..255 CDD:293786 5/28 (18%)
ANK repeat 257..288 CDD:293786 4/31 (13%)
ANK repeat 290..321 CDD:293786 9/37 (24%)
ANK repeat 323..354 CDD:293786 3/11 (27%)
ANK repeat 356..387 CDD:293786
Ank_4 359..407 CDD:372654
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165171267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.