DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trus and SPAC13G6.09

DIOPT Version :9

Sequence 1:NP_650205.1 Gene:trus / 41540 FlyBaseID:FBgn0038055 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_592835.1 Gene:SPAC13G6.09 / 2542826 PomBaseID:SPAC13G6.09 Length:274 Species:Schizosaccharomyces pombe


Alignment Length:173 Identity:40/173 - (23%)
Similarity:66/173 - (38%) Gaps:52/173 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 LKSYYIAVDVENKTQAEEYENFGGALSMDHIRDLYQEYKLRDQNPGQSPTGGASGPGEQGDENES 372
            :.|..|.||.|.|.:.::           .|.:..:..|:..:||...|                
pombe   115 IDSSEIEVDAEPKEENKK-----------EIPEKLKNVKVDTENPSAEP---------------- 152

  Fly   373 YEKALPAHGDLVFHNFITTIHQNPGQLLRY-------------SRDTIPLLVAPFTEPLPKCQNC 424
            |.|   |.||:.|..|...:.:.|.|::||             :.:.||       ..:|.|. |
pombe   153 YTK---AKGDVSFLKFQKRLSRAPDQIMRYYHATSNEFPGLWCNNECIP-------SSIPNCA-C 206

  Fly   425 RGETICEVQLLPTLIPKLRFQVNGCNAPIEFGNVLVFTCLKSC 467
            ..:...|.|:|||||..:....:..|| :::|.:.::.|..||
pombe   207 GAKRQLEFQILPTLISSMNIDHSAKNA-LDWGILSIYVCSASC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trusNP_650205.1 PDCD2_C 371..482 CDD:282100 29/110 (26%)
SPAC13G6.09NP_592835.1 PDCD2_C 158..263 CDD:282100 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2061
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54449
OrthoFinder 1 1.000 - - FOG0001596
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1686
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.