DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-42

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001023799.1 Gene:srw-42 / 3565714 WormBaseID:WBGene00005789 Length:382 Species:Caenorhabditis elegans


Alignment Length:377 Identity:71/377 - (18%)
Similarity:128/377 - (33%) Gaps:132/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKFLMILILGF-----------------GFMFVFTAFQTMCNIEKTILDSISQE--------- 39
            :|...::|.::||                 ..:|:|.....:|::.:.|...:|:.         
 Worm    37 IDLASVVISVVGFFTNIFHLAVLTRKSIRNSSVFIFLIGIAICDLVRMISIIVSKSPIFYRVLLS 101

  Fly    40 ---DDT-FKGEGYTSLAIIY---------LFFSLSNWLAPSFISFT--------GPRVAMVV--- 80
               |.| |....|  ||:|:         :...||.|||.....|.        ..|::.:|   
 Worm   102 LFIDSTCFTPRSY--LAMIFDLISNILEIISLDLSVWLAVFMTIFRVLVIRYPFNKRISSLVTSK 164

  Fly    81 -GALTYTAFMITFMFPSTVLLYVGSAVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQC 144
             |..|.....| .:||..:|.|....:                          |...::.....|
 Worm   165 SGLCTVIPLSI-IIFPFGLLYYFQVTI--------------------------RPVSIWKPSSDC 202

  Fly   145 SMFIGNLF-VYYQFQDKTRIDKETRNLVIGVL------TVIAVLGIVF--LAALRFMADNAEHDN 200
            ..|..|.| :.|:| ..|.:.        |||      |:|.|.|::|  :.::..:...:....
 Worm   203 LGFQSNFFQINYKF-SATELS--------GVLGTDTIETMIHVDGVLFKLIPSIVLLVATSVLVF 258

  Fly   201 ELEQKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLELSFFSGVFGSAIGFTT--KIAETP 263
            |: :||.   :.|:|.::......|.|     |.||.|   .:|...:....|.:..  |:||.|
 Worm   259 EI-RKHK---KTIWAQRNKSNKDWTTK-----LVFFVT---FTFLIAIVPQGIAYIIMFKMAEIP 311

  Fly   264 KEIVGLVGICIGAGEVFGGGLFGILGNKTTRYGRDPIVIAGYVMHMAAFFMT 315
              |:.::.:.:.:       :|..|.           |:.|.:..:..:||:
 Worm   312 --ILRIIAMSLPS-------VFSFLS-----------VVNGTIHFLIFYFMS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 70/370 (19%)
srw-42NP_001023799.1 TM helix 1 37..61 CDD:320109 4/23 (17%)
7TM_GPCR_Srw 40..357 CDD:370978 70/374 (19%)
TM helix 2 70..100 CDD:320109 5/29 (17%)
TM helix 3 121..143 CDD:320109 5/21 (24%)
TM helix 4 164..180 CDD:320109 4/16 (25%)
TM helix 5 231..254 CDD:320109 5/22 (23%)
TM helix 6 277..302 CDD:320109 8/32 (25%)
TM helix 7 318..343 CDD:320109 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.