| Sequence 1: | NP_650203.3 | Gene: | CG18549 / 41538 | FlyBaseID: | FBgn0038053 | Length: | 436 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023883.2 | Gene: | srw-34 / 3565702 | WormBaseID: | WBGene00005781 | Length: | 380 | Species: | Caenorhabditis elegans |
| Alignment Length: | 172 | Identity: | 43/172 - (25%) |
|---|---|---|---|
| Similarity: | 62/172 - (36%) | Gaps: | 52/172 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 199 DNELEQKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLEL--SFFSGVFGSAIGFTTKIAE 261
Fly 262 T-PKEIVGLVGICIGAGEVFGGGLFGILGNKTTRYGRDPIVIAGYVMHMAAFFMTFINL--PNSA 323
Fly 324 PFKDTTDISYLDPPR---ASIAL-VC---AFLLGLGDACFNT 358 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18549 | NP_650203.3 | MFS_MFSD11 | 8..423 | CDD:340965 | 43/172 (25%) |
| srw-34 | NP_001023883.2 | TM helix 1 | 41..67 | CDD:341315 | 7/38 (18%) |
| 7TM_GPCR_Srw | 44..350 | CDD:370978 | 36/147 (24%) | ||
| TM helix 2 | 74..103 | CDD:341315 | 9/50 (18%) | ||
| TM helix 3 | 125..154 | CDD:341315 | 9/26 (35%) | ||
| TM helix 4 | 168..188 | CDD:341315 | |||
| TM helix 5 | 232..257 | CDD:341315 | |||
| TM helix 6 | 270..300 | CDD:341315 | |||
| TM helix 7 | 313..339 | CDD:341315 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3098 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||