DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-38

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_507842.1 Gene:srw-38 / 191017 WormBaseID:WBGene00005785 Length:367 Species:Caenorhabditis elegans


Alignment Length:323 Identity:63/323 - (19%)
Similarity:109/323 - (33%) Gaps:116/323 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VFTAFQTMCNIEKTILDSISQEDDTFKGEGYTSLAI---IYLFFSLSNWLAPSFISFTGPRVAMV 79
            :|....|:|.|...|.:.|  |........|.|..|   .:.|.|.|..::..:.|.|.   |:|
 Worm    68 LFLIGMTLCGIIHMICNII--EFCPLLYNYYFSFEISFECFPFASYSKIVSNYYSSMTN---AVV 127

  Fly    80 VGALTY-TAFM--ITFM---FPST--------------VLLYVGSAVLGLGASITWTGQGTYLAR 124
            .|.||| |..|  |.|:   ||..              :||.:...:|.|           ::|.
 Worm   128 TGMLTYFTVAMAIIRFLVVKFPFARSMQRLIYSKSGLKILLPIIILILPL-----------WIAE 181

  Fly   125 CSESSTISRNSGVFWALLQCSMFIGNL--------------------FVYYQFQDKTRIDKETRN 169
            .|.::.:  .:|::.....|.:|..|.                    .|||.:   ..|.:...:
 Worm   182 ISSTNIV--ETGIWVPGPNCDIFAENYTEKMYTVETSITFGIDDFYWIVYYIY---AVIFQFIPS 241

  Fly   170 LVIGVLTVIAVL--------------------GIVFLAALRFMADNAEHDNELEQKHTGCGQAIY 214
            :::.:.||:.::                    .:|....:.|:..||.:            ..||
 Worm   242 ILLPISTVLLIIELKKNKKTKTWTSKSQDRSTKLVVYMTISFIMANAPY------------SLIY 294

  Fly   215 ALKSAGQLFLTKKMLLLSL---AFFYTGLE------LSFFSGVFGSAIGFTTKIAETPKEIVG 268
            :|  :..|....:|::..|   |:..|.|.      |.:|         .:|:...|.:||:|
 Worm   295 SL--SFMLSAYARMIISQLSVIAYLLTTLNVATHWLLCYF---------MSTQYRNTAREILG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 63/323 (20%)
srw-38NP_507842.1 7TM_GPCR_Srw 39..348 CDD:370978 63/323 (20%)
TM helix 2 66..91 CDD:341315 7/24 (29%)
TM helix 3 109..147 CDD:341315 14/40 (35%)
TM helix 4 162..186 CDD:341315 6/34 (18%)
TM helix 5 225..250 CDD:341315 5/27 (19%)
TM helix 6 270..297 CDD:341315 7/40 (18%)
TM helix 7 309..334 CDD:341315 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.