DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-59

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_506996.1 Gene:srw-59 / 186771 WormBaseID:WBGene00005806 Length:349 Species:Caenorhabditis elegans


Alignment Length:284 Identity:58/284 - (20%)
Similarity:105/284 - (36%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FVFTAFQTMCNIEKTILDSISQEDDTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVG 81
            |:|..|        |.:..:.|:...:.|.....|.:|.|.:||| ..|.:.||.......:.|.
 Worm   110 FLFVHF--------TPIPRVFQDLAVWFGVAMAVLRVIILKYSLS-LKAQNLISSNSGIWILFVV 165

  Fly    82 ALTYTAFMITFMFPSTVLLYVGSAVLGLG-ASITWT--------GQGTYLARCSESSTISRNSGV 137
            .|.:..:.| |.|..|.:...|...:..| |:.|:|        |...|     ::.|:....|:
 Worm   166 CLPHIVYWI-FEFQWTEIREYGIWEIPSGCANFTYTSPRIIYSMGPEEY-----QNETLLLVEGI 224

  Fly   138 FWALLQCSMFIGNLFVYYQFQDKTRIDKETRNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNEL 202
            |:.|:.                         ::::.::|::.   |.||..::  ...|.::|  
 Worm   225 FFTLIP-------------------------SIILPIVTIVL---IYFLKTMK--RSTASNNN-- 257

  Fly   203 EQKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLE----LSFFSGVFGSAIGFTTKIAETP 263
              .|......:.||.:...|..|   :.|.:.:.|...:    :|||..:|.....|.:.|..| 
 Worm   258 --NHNARSTKMVALVTVTFLLAT---VPLGITYLYQHTDFSFGISFFCSMFVIICEFVSLINGT- 316

  Fly   264 KEIVGLVGICIGA------GEVFG 281
              :..|:.:||.:      .|:||
 Worm   317 --MHFLLCVCISSQYQRIVREMFG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 58/284 (20%)
srw-59NP_506996.1 7TM_GPCR_Srw 31..340 CDD:370978 58/284 (20%)
TM helix 1 34..53 CDD:320109
TM helix 2 62..84 CDD:320109
TM helix 3 113..135 CDD:320109 4/29 (14%)
TM helix 4 160..176 CDD:320109 3/16 (19%)
TM helix 5 216..239 CDD:320109 4/47 (9%)
TM helix 6 261..286 CDD:320109 5/27 (19%)
TM helix 7 301..326 CDD:320109 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.