Sequence 1: | NP_650203.3 | Gene: | CG18549 / 41538 | FlyBaseID: | FBgn0038053 | Length: | 436 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507151.2 | Gene: | srw-29 / 184965 | WormBaseID: | WBGene00005776 | Length: | 361 | Species: | Caenorhabditis elegans |
Alignment Length: | 229 | Identity: | 47/229 - (20%) |
---|---|---|---|
Similarity: | 78/229 - (34%) | Gaps: | 49/229 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 RVAMVVGALTYTAFMITFMFPSTVLLYVGSAVLGLGASITWTGQGTYLARCSESST-ISRNSGVF 138
Fly 139 WALLQCSMFIGNLFVYYQFQDKTRIDKETRNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNELE 203
Fly 204 QKHTGCGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLE--LSFFSGVFGS----AIGFTTKIAET 262
Fly 263 PKEIVGLVG-----ICI--------GAGEVFGGG 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18549 | NP_650203.3 | MFS_MFSD11 | 8..423 | CDD:340965 | 47/229 (21%) |
srw-29 | NP_507151.2 | 7TM_GPCR_Srw | 36..346 | CDD:370978 | 44/225 (20%) |
TM helix 2 | 66..92 | CDD:341315 | |||
TM helix 3 | 110..140 | CDD:341315 | |||
TM helix 4 | 154..185 | CDD:341315 | 7/34 (21%) | ||
TM helix 5 | 218..243 | CDD:341315 | 4/27 (15%) | ||
TM helix 6 | 265..295 | CDD:341315 | 5/29 (17%) | ||
TM helix 7 | 309..334 | CDD:341315 | 6/24 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3098 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |