DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-39

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001343561.1 Gene:srw-39 / 184662 WormBaseID:WBGene00005786 Length:266 Species:Caenorhabditis elegans


Alignment Length:316 Identity:61/316 - (19%)
Similarity:107/316 - (33%) Gaps:115/316 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DTFKGEGYTSLAIIYLFFSLSNWLAPSFISFTGPRVAMVVGALTY-TAFMITF--MFPS------ 96
            :.|:|:.:         ...|:|:..             :.|..| |.|:|:|  :|||      
 Worm    13 EEFRGDAW---------LKFSSWINS-------------ISAYLYLTDFIISFIGIFPSLFHFWI 55

  Fly    97 ---TVLLYVGSAVLGLGASITWTGQGTYLARCSESSTISRNSGVFWALLQCSMFIGNLFVYY--- 155
               |.:.::.:.:..:|.::           |          |:...:.....|...|:.||   
 Worm    56 LTRTYMRHLTTNLFLIGITV-----------C----------GIIHIICNIIEFFPMLYDYYLSF 99

  Fly   156 -------QFQDKTRI-----DKETRNLVIGVLTVIAVLGIVFLAALRFMADNAEHDNELEQKHTG 208
                   .|...::|     ...|..:|.|:||...|.    :|.:||:....       ...:|
 Worm   100 KVPSECFPFAPYSKIVSNYYSSMTNAVVTGMLTYFTVA----MAIIRFLVVKF-------PLASG 153

  Fly   209 CGQAIYALKSAGQLFLTKKMLLLSLAFFYTGLELSFFSGVFGSAIGFTTKIAETPKEIVGLVGI- 272
            ..:.||: ||..::.|...:|:|.|..    .|:|            :|.|.||        || 
 Worm   154 MQRLIYS-KSGLKILLPIIILILPLWI----AEIS------------STNIVET--------GIW 193

  Fly   273 -----CIGAGEVFGGGLFGILGNKTTRYGRDPIVIAGYVMHMAAF-FMTFINLPNS 322
                 |.|..|.:...::.:  ..:..:|.|......|.::...| |:..|.||.|
 Worm   194 VPGPNCDGFAENYTEKMYTV--ETSITFGIDEFYWIVYYIYAVIFQFIPSILLPIS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 61/316 (19%)
srw-39NP_001343561.1 7tm_GPCRs 39..>255 CDD:391938 54/268 (20%)
TM helix 2 66..94 CDD:341315 5/48 (10%)
TM helix 3 112..147 CDD:341315 10/38 (26%)
TM helix 4 162..186 CDD:341315 7/39 (18%)
TM helix 5 225..250 CDD:341315 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.