DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and srw-44

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_507223.1 Gene:srw-44 / 184480 WormBaseID:WBGene00005791 Length:385 Species:Caenorhabditis elegans


Alignment Length:283 Identity:53/283 - (18%)
Similarity:98/283 - (34%) Gaps:85/283 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TISRNSGVFWALLQCSMFIGNLFVYYQFQDKTRIDKETRNLVI---GVLTVIAVLGIV------- 184
            |:|.|..|::|:.        :.::.....:..::|..::|:.   |:.|||.:..::       
 Worm   132 TVSMNLSVWFAVF--------MTIFRALAIRYPLNKRIKSLITSESGLCTVITITILILPFCCLS 188

  Fly   185 -FLAALRFMADNAEHDNELEQKHTGCGQAIYAL------------------KSAGQLFLTKKMLL 230
             ||..| |.|.........::...|..|..|.|                  |..|.||.....::
 Worm   189 FFLRTL-FPASTWYPSPGCKKFSKGYTQIQYRLLATELSGELGTETSEIMQKVEGLLFKFLPSVV 252

  Fly   231 LSLAFFYTGLELSFFSGVFG------------------------SAIGFTTKIAETPKEIVGLVG 271
            ||||         .|:.||.                        |.:.||..||..|:.|:.::.
 Worm   253 LSLA---------TFALVFAIRKHKKKNCTPGNKSDKEKTTKLVSFVTFTFLIAIVPQGILFMIM 308

  Fly   272 ICIGAGEVFGGGLFGILGNKTTRYGRDPIVIAGYVMHMAAFFMTFINLPNSAPFKDTTDISYLDP 336
            .     :||...:.|.:.::.:.......||.|.:..:..:||       .:.::.|....:...
 Worm   309 F-----KVFETSMMGAVIDELSTALSFLSVINGTIHLLIIYFM-------CSEYRKTIRCMFCRK 361

  Fly   337 PRASIALVCAFLLGLGDACFNTQ 359
            .:.||:.:.  |...|:...||:
 Worm   362 SKPSISAIT--LTETGNMTHNTK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 53/283 (19%)
srw-44NP_507223.1 TM helix 1 41..65 CDD:320109
7TM_GPCR_Srw 44..361 CDD:370978 47/258 (18%)
TM helix 2 74..96 CDD:320109
TM helix 3 125..147 CDD:320109 5/22 (23%)
TM helix 4 172..188 CDD:320109 3/15 (20%)
TM helix 5 235..258 CDD:320109 8/31 (26%)
TM helix 6 282..306 CDD:320109 7/23 (30%)
TM helix 7 322..347 CDD:320109 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3098
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.