DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18549 and Y73B6A.1

DIOPT Version :9

Sequence 1:NP_650203.3 Gene:CG18549 / 41538 FlyBaseID:FBgn0038053 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_501030.2 Gene:Y73B6A.1 / 177434 WormBaseID:WBGene00022228 Length:414 Species:Caenorhabditis elegans


Alignment Length:185 Identity:46/185 - (24%)
Similarity:65/185 - (35%) Gaps:53/185 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ISFTGPRVAMVVGALTYTAFMITFMFPSTVLLYVGSAVLGLGASITWTGQGTYLARCSESST--- 130
            :.:.|.|.||.|..:.......|.....||:..|||||............|.||.. ..|.|   
 Worm   181 VRWNGRRAAMKVLHVPGEISADTAKDEITVMKKVGSAVFRKKNPSFLEFLGAYLVE-GHSKTDPK 244

  Fly   131 --ISRNSG-----------VFWALLQCSMFIGNLFVYYQFQDKTRIDKETRN----LVIGVLTVI 178
              ....:|           :|..|::....||:      |..||  |.|.::    ||:|::|..
 Worm   245 LQFKNKNGHPLPEKAQFVAIFMELVEGGRSIGD------FPFKT--DNERKSFVCQLVVGLMTAQ 301

  Fly   179 AVLG-----------IVFLAALRFMADNAEHDNELEQKHTGCGQAIYALKSAGQL 222
            ..||           ||....||.:|...|            |:|: .||::|.|
 Worm   302 KELGFSHGDLSVDNTIVTKTKLRTVAYILE------------GKAV-KLKTSGVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18549NP_650203.3 MFS_MFSD11 8..423 CDD:340965 46/185 (25%)
Y73B6A.1NP_501030.2 H15 24..92 CDD:381790
PKc 170..380 CDD:270622 46/185 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D663893at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.