DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Desat2 and scd

DIOPT Version :9

Sequence 1:NP_650201.1 Gene:Desat2 / 41536 FlyBaseID:FBgn0043043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001027500.1 Gene:scd / 613092 XenbaseID:XB-GENE-988226 Length:338 Species:Xenopus tropicalis


Alignment Length:324 Identity:176/324 - (54%)
Similarity:232/324 - (71%) Gaps:5/324 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ETGVLFEDD--AQTVDGDLTTDRFQLKRAE-KRRLPLVWRNIILFALVHLAALYGLHSIFTRAKL 77
            |:..:.:|:  |..|..|...|...:|:.: |..:.|||||:||.||:|..|.|||..| ..||.
 Frog    14 ESPSIIQDEIGADRVMTDDIFDTTYIKKVDFKPPIKLVWRNVILMALLHFGAFYGLFMI-PAAKP 77

  Fly    78 ATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLLLVIFNTIAFQDAVYHWARDHRVHHKY 142
            .|..:|...:::..|||||||||||:||:||||.|||:.|.:.|::|||:.:|.|||||||||||
 Frog    78 ITLAWAILCFMLSALGVTAGAHRLWSHRSYKAKLPLRIFLAVVNSMAFQNDIYEWARDHRVHHKY 142

  Fly   143 SETDADPHNATRGFFFSHVGWLLCKKHPDIKEKGRGLDLSDLRADPILMFQRKHYYILMPLACFV 207
            ||||||||||.|||||||:||||.:||||:.|||:.||||||:||.::||||::|.:.:.:.||:
 Frog   143 SETDADPHNAVRGFFFSHIGWLLMRKHPDVIEKGKKLDLSDLKADKVVMFQRRNYKLSILVMCFI 207

  Fly   208 LPTVIPMVYWNETLASSWFVATMFRWCFQLNMTWLVNSAAHKFGNRPYDKTMNPTQNAFVSAFTF 272
            ||||||..:|:|:.:.:::|..:.|:...||.|||||||||.:||||||:|:||.:|..|:....
 Frog   208 LPTVIPWYFWDESFSVAFYVPCLLRYALVLNATWLVNSAAHMYGNRPYDQTINPRENPLVAIGAI 272

  Fly   273 GEGWHNYHHAFPWDYKTAEWGCYSLNITTAFIDLFAKIGWAYDLKTVAPDVIQRRVLRTGDGSH 336
            |||:|||||.||:||.|:|:| ...||||.||||...:|.|.|.|.|:.:.|..|..|||||||
 Frog   273 GEGFHNYHHTFPFDYSTSEFG-LKFNITTGFIDLMCLLGLANDCKRVSKETIMARKKRTGDGSH 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Desat2NP_650201.1 Delta9-FADS-like 76..317 CDD:239582 141/240 (59%)
FA_desaturase 81..284 CDD:278890 121/202 (60%)
scdNP_001027500.1 Delta9-FADS-like 76..316 CDD:239582 141/240 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 292 1.000 Domainoid score I1499
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74538
Inparanoid 1 1.050 373 1.000 Inparanoid score I2063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D296120at33208
OrthoFinder 1 1.000 - - FOG0000495
OrthoInspector 1 1.000 - - otm47596
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16
SonicParanoid 1 1.000 - - X207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.