DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and CDY2A

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_004816.1 Gene:CDY2A / 9426 HGNCID:1810 Length:541 Species:Homo sapiens


Alignment Length:248 Identity:69/248 - (27%)
Similarity:116/248 - (46%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GQQARFTAASRTFSSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGIN-RPQQRNAIDSLTAS 77
            |.|...|..||.....|.:|......|: |...::|:|:|:...|.|.:: |..::||:::....
Human   253 GGQRNITDDSRGQPFIKKMHFTIRLTES-AITYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIK 316

  Fly    78 QLCDAFANFEADDTSPVAVLYGVGGS-FCSGFD---ILEISTDEKEEISVDILMRPEGSVGPTRR 138
            ::.:|..:..|||:.  .||:...|| ||.|.|   .:....:::...|::::...:..|. |..
Human   317 EMVNALNSAAADDSK--LVLFSAAGSVFCCGLDFGYFVRHLRNDRNTASLEMVDTIKNFVN-TFI 378

  Fly   139 QIKKPVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRAL 203
            |.|||:|..:||..|..|..:..:|||....|.|........||.......:|..|.|:|.:.|.
Human   379 QFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASAN 443

  Fly   204 DLILTGRPVGSQEAHDIGLVNRIVPTGT------------ALGNALELATCLA 244
            ::::.||.:.::||...|||:::..|||            |..||:.|..|.|
Human   444 EMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 60/213 (28%)
CDY2ANP_004816.1 CHROMO 5..58 CDD:214605
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..104
crotonase-like 287..483 CDD:119339 54/198 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.