DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and DCI1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_014823.3 Gene:DCI1 / 854352 SGDID:S000005706 Length:271 Species:Saccharomyces cerevisiae


Alignment Length:314 Identity:63/314 - (20%)
Similarity:110/314 - (35%) Gaps:95/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IDSLTASQLCDAFANF--------EADDTSPV--AVLYGVGGSFCSGFDILEIS-------TDEK 118
            ::|||       |.:|        :|:|...|  .||...|..|.||.....::       |.|.
Yeast    24 LNSLT-------FEDFVYIALLLHKANDIDSVLFTVLQSSGKYFSSGGKFSAVNKLNDGDVTSEV 81

  Fly   119 EEIS--VDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESAV-------- 173
            |::|  |..:..|...|.......||.:||.:||..|.....|..:||:...:..:|        
Yeast    82 EKVSKLVSAISSPNIFVANAFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSN 146

  Fly   174 LGFFNRRFGVPMLDAGT-IRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNAL 237
            |||        :.:.|| :.|...:|::.|.:.::...||..:|     |:..|:.....|.|  
Yeast   147 LGF--------VAEVGTSVTLTQKLGINSANEHMIFSTPVLFKE-----LIGTIITKNYQLTN-- 196

  Fly   238 ELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSREIIEDMQNGIKWFNQTFKPDT 302
                                       |.||::.|..::......:......|:|        :.
Yeast   197 ---------------------------TETFNEKVLQDIKQNLEGLYPKSVLGMK--------EL 226

  Fly   303 THSWLKRDRSMADWDDEEVAEAAAQKEKLKQEQEAALAEAEKQKQAEKAQKRSK 356
            .||.:|          :::.:|.|.:........|:....::.||.::..:|.|
Yeast   227 LHSEMK----------QKLIKAQAMETNGTLPFWASGEPFKRFKQLQEGNRRHK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 47/215 (22%)
DCI1NP_014823.3 CaiD 1..264 CDD:223955 61/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.