DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ECI1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_013386.1 Gene:ECI1 / 850990 SGDID:S000004274 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:171 Identity:35/171 - (20%)
Similarity:66/171 - (38%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LIGINRPQQRNAI---DSLTASQLCDAFANFEADDTSPV--AVLYGVGGSFCSGFDILEISTDEK 118
            :|.:..|...||:   |.:...:|.:.     ||....|  .::...|..|.||.|...|:..:.
Yeast    21 IIHLMNPDNLNALEGEDYIYLGELLEL-----ADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQG 80

  Fly   119 EEIS----------VDILMRPEGSVGPTRRQIK--KPVVCGINGYCIANGLELALMCDL-RVMEE 170
            ::.:          .:.:.|   :|..|...||  |.::|.:||..|.....|..:||: ..:.:
Yeast    81 DDTNKYPSETSKWVSNFVAR---NVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSIND 142

  Fly   171 SAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRP 211
            ...|.:.....|:......|:.||...|.:...:.::..:|
Yeast   143 KVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 35/171 (20%)
ECI1NP_013386.1 CaiD 6..243 CDD:223955 35/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.