DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ECHID

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_176255.2 Gene:ECHID / 842350 AraportID:AT1G60550 Length:337 Species:Arabidopsis thaliana


Alignment Length:199 Identity:57/199 - (28%)
Similarity:91/199 - (45%) Gaps:34/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NILVEK--DKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVG-GSFCSGFD 109
            :|:.||  |:.|..|.||||::|||....|..:|..||.:...|.:..|.:|.|.| .:||||.|
plant    76 DIIYEKALDEGIAKITINRPERRNAFRPQTVKELMRAFNDARDDSSVGVIILTGKGTKAFCSGGD 140

  Fly   110 ILEISTDEKEEISVDILMRPEGSVGPTR-------------RQIKKPVVCGINGYCIANGLELAL 161
                          ..|...:|...|..             |::.|||:..:.||.:..|..|.:
plant   141 --------------QALRTQDGYADPNDVGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHILHM 191

  Fly   162 MCDLRVMEESAVLGFFNRRFGVPMLDA--GTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVN 224
            :|||.:..::|:.|....:.|  ..||  |:..:..::|..:|.::....|...:.||..:||:|
plant   192 VCDLTIAADNAIFGQTGPKVG--SFDAGYGSSIMSRLVGPKKAREMWFMTRFYTASEAEKMGLIN 254

  Fly   225 RIVP 228
            .:||
plant   255 TVVP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 57/198 (29%)
ECHIDNP_176255.2 PLN02921 7..337 CDD:178509 57/199 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.