DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and AT4G16800

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_193413.2 Gene:AT4G16800 / 827386 AraportID:AT4G16800 Length:301 Species:Arabidopsis thaliana


Alignment Length:270 Identity:76/270 - (28%)
Similarity:121/270 - (44%) Gaps:20/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EAAPPK----NILVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYG-VG 101
            |.:||:    |.|...|..|..:.::||..:|||:......|.:||.:...|:::.|.::.. |.
plant    36 ETSPPEFVKLNRLSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVP 100

  Fly   102 GSFCSGFDILEISTDEKEEISVDILMRPEGSVGPTR------RQIKKPVVCGINGYCIANGLELA 160
            |.||:|.|:.|..|....|:..        .|...|      ..:..|.:..|.|..:..|||:|
plant   101 GVFCAGADLKERRTMSPSEVHT--------YVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMA 157

  Fly   161 LMCDLRVMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNR 225
            |.||||:..|:||.|.......:.....||.||..::|.|.:.:||.|||.:.:.||.:.||||.
plant   158 LACDLRICGENAVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNI 222

  Fly   226 IVPTGTALGNALELATCLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSREIIEDMQNG 290
            .|..|.|...|:|:|..:.:....|:...:.:: ....||:........|:.:......:|...|
plant   223 CVTAGEAHEKAIEMAQQINEKGPLAIKMAKKAI-DEGIETNMASGLEVEEMCYQKLLNTQDRLEG 286

  Fly   291 IKWFNQTFKP 300
            :..|.:..||
plant   287 LAAFAEKRKP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 64/216 (30%)
AT4G16800NP_193413.2 PLN02600 51..300 CDD:178210 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.