DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ECHDC3

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_078969.3 Gene:ECHDC3 / 79746 HGNCID:23489 Length:303 Species:Homo sapiens


Alignment Length:332 Identity:79/332 - (23%)
Similarity:143/332 - (43%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRKFG--GLLAQQVGQQARFTAASRTFSSTKALHKDPA---TQEAEAAPPKNILVEKDKNITLI 60
            :||.||  |.:..:.|..|:..|   .|.|     :|||   .:|:|..|.....::..:||.| 
Human     6 VLRAFGASGPMCLRRGPWAQLPA---RFCS-----RDPAGAGRRESEPRPTSARQLDGIRNIVL- 61

  Fly    61 GINRPQQRNAID-----SLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEISTDEKEE 120
              :.|::|||:.     ||.:..|.||.:|     ...|.::...|..|.||.|:.|::.::..:
Human    62 --SNPKKRNALSLAMLKSLQSDILHDADSN-----DLKVIIISAEGPVFSSGHDLKELTEEQGRD 119

  Fly   121 ISVDILMRPEGSVGPTRRQIKK---PVVCGINGYCIANGLELALMCDLRVMEESAVLGFFNRRFG 182
            ...::..    :.......|:.   ||:..:||...|.|.:|...||:.|..:.:       .|.
Human   120 YHAEVFQ----TCSKVMMHIRNHPVPVIAMVNGLAAAAGCQLVASCDIAVASDKS-------SFA 173

  Fly   183 VPMLDAGTIRLPAMIGLSR------ALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNALELAT 241
            .|.::.|.......:.|:|      ||:::.||.|:.:|||...||::::||........:.:|.
Human   174 TPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIAR 238

  Fly   242 CLAKFPQRALIHDRNSVYSSTFETSTFHQAVQNEV----MFTSREIIE-----DMQNGIKWFNQT 297
            .:|...:..:          :...:||::.:..::    ..||:.:::     |.|.||..|.|.
Human   239 KIASLSRPVV----------SLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQK 293

  Fly   298 FKPDTTH 304
            .||..:|
Human   294 RKPVWSH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 50/223 (22%)
ECHDC3NP_078969.3 crotonase-like 54..301 CDD:329030 63/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.