DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and hadhab

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001082906.1 Gene:hadhab / 793834 ZFINID:ZDB-GENE-041111-204 Length:763 Species:Danio rerio


Alignment Length:328 Identity:81/328 - (24%)
Similarity:141/328 - (42%) Gaps:69/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGQQARFTAASRTF--SSTKALHKDPATQEAEAAPPKNILVEKDKNITLIGINRPQQRNAIDSLT 75
            :|..:|.|....|.  ..|:...|..|...|..    ::..|...::.::.:|.|..:  :::|:
Zfish     7 LGSLSRLTTRRYTLFPGVTRRTFKFAACMMART----HVSYEVKGDVAVVRMNDPTAK--VNTLS 65

  Fly    76 ASQ-------LCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEI-STDEKEEISVDILMRPEGS 132
            ...       :.:.:.|   .....|.::....|.|.:|.||..| :....||::.   :..|| 
Zfish    66 VQMQKDMTEVMDEVWGN---SAVQSVVLISSKPGCFIAGADISMIKACKTAEEVTG---LSQEG- 123

  Fly   133 VGPTRRQIK------KPVVCGINGYCIANGLELALMCDLRVMEES--AVLGFFNRRFGVPMLDAG 189
                :|..:      ||:|..|||.|:..|||.|:.|..|:..:|  .|||......|:.....|
Zfish   124 ----QRMFEKIEKSPKPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGCPEVMLGLLPGAGG 184

  Fly   190 TIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPT-GTALGN------------ALELAT 241
            |.|||.|:||..|.|::||||.:.:.:|..:|||:::|.| |..|.:            |:|.|.
Zfish   185 TQRLPKMLGLPSAFDVMLTGRSIRADKAKKMGLVHQLVDTLGPGLKSPEERTIEYLEEVAVEAAR 249

  Fly   242 CLAK----------FPQRALIHDRNSVYSSTFETSTFHQAVQNEVMFTSR-------EIIEDMQN 289
            .||:          :.|:.    ::.|.|..|.....:..|:.:||..::       :|||.::.
Zfish   250 GLAQKKITLTKEKGWMQKI----QDYVMSYPFVRQQIYNTVEKKVMKQTKGLYPAPLKIIESVKA 310

  Fly   290 GIK 292
            |::
Zfish   311 GVE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 63/248 (25%)
hadhabNP_001082906.1 fa_ox_alpha_mit 27..762 CDD:131494 76/308 (25%)
crotonase-like 41..251 CDD:119339 60/222 (27%)
3HCDH_N 363..541 CDD:280833
3HCDH 544..639 CDD:279114
3HCDH 676..>750 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.