DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and cdyl

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_696879.5 Gene:cdyl / 568457 ZFINID:ZDB-GENE-070912-561 Length:581 Species:Danio rerio


Alignment Length:220 Identity:58/220 - (26%)
Similarity:108/220 - (49%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KNILVEKDKNIT-LIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDI 110
            ::|:|:|....| ::...:..:.|:::.....::..|.|...||| |.:.:|.|||..||.|.|.
Zfish   325 RDIVVKKQDGFTHILFSTKTSENNSLNPDVMKEVQSAMATAAADD-SKLVLLSGVGSVFCFGLDF 388

  Fly   111 LEI---STDEKEEISVDILMRPEGSVGPTRRQIKKPVVCGINGYCIANGLELALMCDLRVMEESA 172
            :..   .||::::.|:.:.......|. |..|.|||::..:||..|..|..:..:||:....|.|
Zfish   389 IYFIRRLTDDRKKESIKMAETIRTFVN-TFIQFKKPIIAAVNGPAIGLGASILPLCDVIWANEKA 452

  Fly   173 VLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALGNAL 237
            ........||.......::..|.::|::.|.:::|:||.:.:|||...|||::::..||.....:
Zfish   453 WFQTPYTTFGQTPDACSSVTFPLIMGVASANEMLLSGRKLTAQEACAKGLVSQVLWPGTFTQEVM 517

  Fly   238 ----ELATC--LAKFPQRALIHDRN 256
                ||.:|  :.....:||:.:.|
Zfish   518 VRIKELVSCNSVVLRESKALVRNIN 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 58/218 (27%)
cdylXP_696879.5 CHROMO 8..61 CDD:214605
crotonase-like 327..523 CDD:119339 52/197 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.