DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and ECHDC2

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_011540011.1 Gene:ECHDC2 / 55268 HGNCID:23408 Length:318 Species:Homo sapiens


Alignment Length:248 Identity:81/248 - (32%)
Similarity:114/248 - (45%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLY---GVGGSFCSGFDIL 111
            |...|:.||.|.:|||..|||:.::..|:|.:..|....|  ..|.||.   ||.|.||:|.|: 
Human    35 LAGPDQGITEILMNRPSARNALGNVFVSELLETLAQLRED--RQVRVLLFRSGVKGVFCAGADL- 96

  Fly   112 EISTDEKEEISVDILMRPEGSVGPTRRQIK----------KPVVCGINGYCIANGLELALMCDLR 166
                .|:|::|       |..||...::::          .|.:..::|:.:..||||||.||||
Human    97 ----KEREQMS-------EAEVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGGLELALACDLR 150

  Fly   167 VMEESAVLGFFNRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGT 231
            |...|||:|......|:.....||.|||..:|::.|.:||.|||.:...|||.:||||..|....
Human   151 VAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNE 215

  Fly   232 ALGNALELATCLAK--FPQ---------------RALIHDRNSVYSSTFETST 267
            ....|.:.|..||:  .||               ..|||...|...|:..:.|
Human   216 EGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTELIHLSTSTLPSSHSSHT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 79/238 (33%)
ECHDC2XP_011540011.1 crotonase-like 38..252 CDD:304874 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.