DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srlp and echdc1

DIOPT Version :9

Sequence 1:NP_650199.1 Gene:Srlp / 41533 FlyBaseID:FBgn0038049 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_031757537.1 Gene:echdc1 / 496886 XenbaseID:XB-GENE-958554 Length:330 Species:Xenopus tropicalis


Alignment Length:187 Identity:52/187 - (27%)
Similarity:86/187 - (45%) Gaps:6/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LVEKDKNITLIGINRPQQRNAIDSLTASQLCDAFANFEADDTSPVAVLYGVGGSFCSGFDILEIS 114
            |.:.|..|..|.||.|.:.||.......:|.:..::.|........::||...:||||.|:..:.
 Frog    82 LSKMDNGIAEICINNPSRMNAFTGTMMIELEERISDLENWKNGKGLIVYGAENTFCSGSDLNAVK 146

  Fly   115 TDEKEEISVDILMRPEGSVGPTRRQIKKPV--VCGINGYCIANGLELALMCDLRVMEESAVLGFF 177
            .....:..:.:.|..:.::  ||.| :.|:  |..|.|..:..|.||...||.|:|.|.:.:.|.
 Frog   147 AISNPQEGMMMCMLMQNTL--TRLQ-RLPLISVALIQGKALGGGAELCTACDFRLMTEGSEIRFV 208

  Fly   178 NRRFGVPMLDAGTIRLPAMIGLSRALDLILTGRPVGSQEAHDIGLVNRIVPTGTALG 234
            :::.|:.....|..||..:||...||.|:.....|..:.|.::||.:.|: .||..|
 Frog   209 HKQMGLVPGWGGAARLIHLIGSRHALKLLSGALRVHPENALELGLADNIL-LGTEDG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrlpNP_650199.1 crotonase-like 49..259 CDD:304874 52/187 (28%)
echdc1XP_031757537.1 crotonase-like 86..273 CDD:119339 51/183 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1234730at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.